SecReT6
Protein ID: 410418581
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0784
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]836160..837437 [+]
Productouter membrane protein
NoteTssL
UniProt IDK0MDR7
KEGG IDbbm:BN115_0784
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.50E-75, Aligned region: 36..241
OmpA [PF00691], Evalue: 7.70E-14, Aligned region: 305..403
RskA [PF10099], Evalue: 0.0029, Aligned region: 179..298
RskA [PF10099], Evalue: 0.0029, Aligned region: 363..387
Protein Sequence: 425 a.a.     [Download]
>gi|410418581|ref|YP_006899030.1| outer membrane protein [Bordetella bronchiseptica MO149]
MHAANPPFPDFGADAAADPGAASRLRPHEYVISGSNPLVAAANPLLDLIPQIRATSAHPAPAMLREYLVD
EVRQFELRAQQAGIPNETILGARYCLCTALDEAAALTPWGGGGVWSAHSLLVTFHNETWGGEKFFQLLAK
LSQNPGQHLDLLELLYYCLLLGFEGRYRVIDNGRTQLETLRQRLLRILRGARGEYPRALSPHWRDTPVQQ
ALRRLPVPLWAYGALAAALALALFWGLSWRLGERSDAVFAAVARLKPPTVQIAPAPRPAPAPRLAVFLQP
EVRDRLVTVRDEVDRSVVVLRGDGLFESGAVAVRDRYAPVLARVAEALGQTRGDIVVRGYTDNVPIRTAR
FPSNWHLSQARAEAVKAVIDARLGQAGRVRAEGRGEADPLAPNDTPAGRSVNRRVEITVMVPPAPHARTP
EGAAP
 
Nucleotide Sequence: 1278 bp     [Download]
>gi|410417816|ref|NC_018829.1|:836160-837437 Bordetella bronchiseptica MO149, complete genome
ATGCACGCCGCCAACCCTCCCTTTCCCGACTTCGGCGCCGACGCGGCGGCCGACCCCGGCGCGGCCAGCC
GGCTGCGCCCGCACGAGTACGTCATCAGCGGCTCCAACCCGCTGGTGGCGGCGGCCAATCCGCTGCTGGA
CCTGATCCCGCAGATCCGCGCCACCAGCGCCCATCCCGCGCCGGCCATGCTGCGCGAGTACCTGGTCGAC
GAAGTGCGCCAGTTCGAGCTGCGCGCGCAACAGGCCGGCATTCCCAACGAAACCATCCTGGGCGCGCGCT
ACTGCCTGTGCACGGCGCTGGACGAGGCCGCCGCGCTCACGCCGTGGGGCGGGGGCGGCGTATGGTCGGC
CCACAGCCTGTTGGTGACCTTCCATAACGAAACCTGGGGCGGCGAGAAGTTCTTCCAGCTGCTGGCCAAG
CTGTCGCAGAACCCGGGCCAGCACCTGGATTTGCTGGAGCTGCTGTACTACTGCCTGCTGCTGGGCTTCG
AGGGCCGCTACCGCGTCATCGACAACGGCCGCACGCAGCTCGAGACCTTGCGCCAGCGCCTGCTGCGCAT
CCTGCGCGGCGCGCGCGGCGAGTATCCGCGCGCGCTCTCGCCGCATTGGCGCGACACGCCGGTGCAGCAG
GCGCTGCGCCGCCTGCCGGTGCCGCTGTGGGCCTACGGGGCGCTGGCGGCGGCGCTGGCGCTGGCGTTGT
TCTGGGGCCTGTCGTGGCGCCTGGGCGAACGCTCGGATGCCGTGTTCGCCGCGGTCGCGCGGCTCAAGCC
GCCCACGGTGCAGATCGCGCCGGCGCCGCGCCCGGCGCCCGCGCCCCGCCTGGCCGTGTTCCTGCAGCCC
GAGGTGCGCGACCGCCTGGTGACGGTGCGCGACGAGGTCGATCGCAGCGTGGTGGTGCTGCGCGGCGACG
GGCTGTTCGAGTCGGGCGCGGTCGCGGTGCGCGACCGCTATGCGCCGGTGCTGGCGCGGGTGGCCGAGGC
GCTGGGCCAGACGCGCGGCGATATCGTGGTGCGCGGCTATACCGACAACGTGCCCATCCGCACGGCGCGC
TTTCCGTCCAACTGGCATCTGTCGCAGGCGCGCGCCGAGGCGGTCAAGGCGGTGATCGACGCGCGCCTGG
GCCAGGCCGGGCGCGTGCGCGCAGAAGGGCGCGGCGAGGCCGACCCGCTGGCGCCCAACGACACCCCCGC
CGGACGCTCGGTCAACCGGCGGGTCGAAATCACCGTGATGGTGCCGCCGGCGCCGCATGCCCGCACGCCC
GAAGGAGCCGCGCCATGA
 Primer design