SecReT6
Protein ID: 410418582
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0785
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]837434..841039 [+]
Producthypothetical protein
NoteTssM
UniProt IDK0MMK4
KEGG IDbbm:BN115_0785
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-99, Aligned region: 72..112
ImcF-related_N [PF14331], Evalue: 1.90E-99, Aligned region: 206..470
IcmF-related [PF06761], Evalue: 6.50E-90, Aligned region: 519..829
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 875..889
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 938..1062
Protein Sequence: 1201 a.a.     [Download]
>gi|410418582|ref|YP_006899031.1| hypothetical protein BN115_0785 [Bordetella bronchiseptica MO149]
MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLESETARVLVIVALFAFALLRLLWRKWRE
GRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELEGRFDEAVELLRKTRFDGGGGRGWLQRYSRQYLYQLP
WYVIIGAPGSGKTTALVNSGLNFPLAERFGKAALRGVGGTRNCDWWFTDDAVLLDTAGRYTTHESDPTGD
EESWRGFLGLLTRFRGRQPINGAMLTVSIEDLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTK
ADLLAGFEQYFASFSREDLEQVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPEVLAAEPDEAR
RALAYLLPQQFAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGGETFDQVTGHLKRYLRIESGPA
PAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYRRLHWAGYGLITLAFLGLAAGWLASYGNNARYL
DEVARRVPTVDKLGRDIKITRSGDVLGLMPFLDGLWYLPRDAAFEPDAPPLSYRFGLYQGGKMHAAMQGV
YRGTLDSVLLPQVARRIEAALRAARADDLEYGYEALRAYLMLYEADHYDAEFMHAWLLSDMQGTLPEGYT
RRQYDLMSLHLRQLAQGGVLASPFPRDEALVRQARDELARHTLAQRAYSRLRRMLAGADDQPPTTAVTLG
GPQASAVFVRKSGKPLAQGIAALYTYRGYWDVFNPRVTRVAERLRSDDAWVLDIAPPGVLDEAARQQLIV
DIKRLYLNDYVARWDGYLDDLALAPRSSLLQSIQLARTLSAPDSPLVRLTQGVARETTLLRDAGGDERSL
ADQARDRVSSTREALEQMFGPTGPGAATRADAGDGKLERVVDQHFEPWRRLARADGQGGAPIAATTSLVN
ELYTYLTAADAALRSASPAPASDVVTKLRAEAGRLPRPLRDVLDDLSTGAAGEVSGVARERLGEDLYATI
GLFCRQAIAGRYPFAPGSPRDVAPNDLARLFAPNGMMDEFFQKNLVSQIDVSEARWRFKPGMDGTPGQAS
ALLDSFQRAAAIRDAYFMAGSAEPAFRVSIRPVEMDPAITQFVMDVDGQTVRYAHGPQVATSVQWPGPRG
ANQVRIELTPQAGAAGLSASGPWALNRLLDQARVTRGASPEISLASFDIGGRKVVLEIRAGSVRSPFHLA
EMRGFSCPGRS
 
Nucleotide Sequence: 3606 bp     [Download]
>gi|410417816|ref|NC_018829.1|:837434-841039 Bordetella bronchiseptica MO149, complete genome
ATGATCCCGCGCCTGTTCGGATGGCTGTTCTCGCGCGGCCTGTGGAGCTTCCTGGGCCTGGTGGCGCTGG
CCCTGCTGGTGTGGATCGCCGGGCCGCTGCTGGCGATCGGCGCGCTGCGCCCGCTGGAAAGCGAGACCGC
GCGCGTGCTGGTCATCGTCGCGCTGTTCGCCTTCGCGCTGCTGCGCCTGCTGTGGCGCAAGTGGCGCGAA
GGCCGCCTCAACGCCCAGCTGCTGGGCCAGCTGCGCCGGCCGGCCCGGCCCGAGGCCGAGGCCGCGGCCG
AGCCGCCGCCTTCGGACCTGCGCGAACTGGAAGGCCGCTTCGACGAGGCGGTGGAGCTGTTGCGCAAGAC
GCGCTTCGACGGAGGCGGCGGGCGCGGCTGGCTGCAGCGCTATTCGCGCCAATACCTGTACCAGCTGCCC
TGGTACGTCATCATTGGCGCGCCAGGCTCGGGCAAGACCACGGCCCTGGTCAACTCGGGCCTGAACTTCC
CGCTGGCCGAGCGCTTCGGCAAGGCCGCGCTGCGCGGCGTGGGCGGCACCCGCAACTGCGATTGGTGGTT
CACCGACGACGCGGTGCTGCTCGATACCGCCGGACGCTACACCACCCATGAAAGCGACCCCACCGGCGAC
GAGGAGTCCTGGCGCGGCTTTCTCGGCCTGTTGACGCGCTTCCGGGGCCGCCAGCCCATCAACGGCGCCA
TGCTCACCGTCAGCATCGAGGACTTGCTGGCCGCTTCCGACGCCGAGCGCGCGCGCCACGCTGCGGTGCT
GCGCCGGCGCCTGCAGGAGCTGCGCGAGCAGCTGGGCATCCATTTCCCGGTGTATGTGCTGGTGACCAAG
GCCGACCTGCTGGCCGGCTTCGAGCAGTACTTCGCCTCGTTCAGCCGCGAAGACCTGGAGCAGGTATGGG
GCTTCACCTTGCCCTACGCGCGCGCCCAGGAGCCGGACTTCGACCTGTACGAAGCCTTTCATGCCGAGTA
CCGGCTGCTGCAGCGCCGGCTCGACGACGCCCTGCCCGAAGTGCTGGCCGCCGAGCCGGACGAGGCGCGC
CGCGCGCTGGCCTACCTGCTGCCGCAGCAGTTCGCCGGCCTGCAGGCCGTGCTGGGCCATTTCCTCAGCG
ACGTGTTCGCCAGCTCGCGCTTCGAGGAGCGCCTGGTGCCGCGCGGCGTGTACTTCACCAGCGGCACCCA
GGGCGGCGAGACCTTCGACCAGGTCACCGGCCACCTCAAGCGCTATCTGCGCATCGAAAGCGGGCCGGCC
CCGGCCGCCGCCGAGGAAGGCCGCAGCTTCTTCCTCAAGCGGCTGCTGCAGGACGTGATCTTTCCCGAGG
CCGGCCTGGCCGGCCGCAACCTGCGCTGGGAGCGCCGCTACCGCCGCCTGCACTGGGCCGGCTACGGCCT
GATCACGCTGGCGTTCCTGGGCCTGGCGGCGGGCTGGCTGGCCAGCTACGGCAACAACGCGCGCTACCTC
GACGAAGTGGCGCGCCGCGTGCCGACGGTGGACAAGCTGGGGCGCGATATCAAGATCACCCGCTCGGGCG
ATGTGCTGGGCCTGATGCCCTTCCTGGACGGCCTGTGGTACCTGCCGCGCGACGCCGCCTTCGAGCCGGA
CGCGCCGCCGCTGTCCTATCGCTTCGGGCTGTACCAGGGCGGCAAGATGCACGCCGCGATGCAGGGCGTT
TATCGCGGCACGCTCGACAGCGTCCTGCTGCCGCAGGTGGCGCGCCGCATCGAGGCGGCGCTGCGCGCGG
CCCGCGCCGACGACCTGGAGTACGGCTACGAGGCCCTGCGCGCCTACCTGATGCTGTACGAGGCCGACCA
CTACGACGCCGAGTTCATGCACGCCTGGCTGCTGTCCGACATGCAGGGCACGCTGCCCGAGGGCTACACG
CGCCGGCAGTACGACCTGATGTCGCTGCACCTGCGCCAGCTGGCGCAGGGCGGCGTGCTGGCCTCGCCGT
TTCCGCGCGACGAGGCGCTGGTGCGGCAGGCGCGCGACGAACTGGCGCGCCACACGCTGGCGCAGCGCGC
CTACAGCCGGCTGCGCCGCATGCTGGCCGGCGCCGACGATCAGCCGCCCACCACCGCGGTGACGCTGGGC
GGGCCGCAGGCCAGCGCCGTCTTCGTGCGCAAGAGCGGCAAGCCGCTGGCCCAGGGCATCGCGGCGCTGT
ACACCTACCGCGGCTATTGGGACGTGTTCAATCCGCGCGTCACGCGCGTGGCCGAGCGCCTGCGCAGCGA
CGATGCCTGGGTCCTGGACATCGCGCCGCCGGGCGTGCTGGACGAGGCCGCGCGCCAGCAGCTCATCGTC
GACATCAAGCGCCTGTACCTCAACGACTACGTGGCGCGCTGGGACGGCTACCTGGACGACCTGGCGCTGG
CGCCGCGCAGCTCGCTGCTGCAAAGCATCCAGCTGGCGCGCACCCTGTCGGCGCCCGATTCGCCGCTGGT
GCGGCTGACCCAGGGCGTGGCGCGCGAGACCACGCTGTTGCGCGACGCGGGCGGCGACGAGCGCTCGCTG
GCGGACCAGGCGCGCGACCGCGTCAGCAGCACGCGCGAGGCGCTGGAGCAGATGTTCGGCCCGACCGGCC
CGGGCGCGGCCACGCGCGCCGACGCCGGCGACGGCAAGCTGGAGCGCGTGGTCGACCAGCACTTCGAGCC
ATGGCGCAGGCTGGCGCGCGCCGACGGGCAGGGCGGCGCGCCGATTGCCGCCACCACCAGCCTGGTCAAC
GAGCTGTACACCTACCTGACGGCGGCCGACGCGGCCCTGCGCAGCGCCAGCCCGGCGCCCGCCTCCGATG
TGGTGACCAAGCTGCGCGCCGAGGCTGGCCGCCTGCCGCGGCCCTTGCGCGACGTGCTCGACGACTTGTC
CACCGGCGCGGCGGGCGAAGTGTCCGGCGTGGCGCGCGAGCGGCTGGGCGAAGACCTGTACGCCACCATC
GGCCTGTTCTGCCGCCAGGCCATCGCCGGCCGCTATCCTTTCGCGCCCGGCTCGCCGCGCGACGTCGCGC
CCAATGACCTGGCGCGGCTGTTCGCGCCCAACGGCATGATGGACGAGTTCTTCCAGAAGAACCTGGTCAG
CCAGATCGATGTGTCCGAGGCGCGCTGGCGCTTCAAGCCGGGCATGGACGGCACGCCGGGCCAGGCGTCG
GCGCTGCTGGATTCGTTCCAGCGCGCCGCCGCGATCCGCGACGCCTATTTCATGGCCGGCAGCGCGGAGC
CGGCGTTTCGCGTCTCGATCCGTCCGGTGGAAATGGACCCGGCCATCACGCAATTCGTCATGGACGTGGA
CGGCCAGACCGTGCGCTATGCGCATGGCCCGCAGGTCGCCACCTCCGTGCAATGGCCGGGGCCGCGCGGC
GCCAACCAGGTGCGCATCGAGCTTACGCCCCAGGCCGGCGCGGCGGGCCTGTCGGCCAGCGGACCGTGGG
CCCTCAATCGCCTGCTCGACCAGGCCCGCGTCACGCGCGGCGCCTCGCCCGAGATCTCGCTGGCCAGCTT
CGATATCGGCGGCCGCAAAGTGGTGCTGGAGATCCGCGCGGGCAGCGTCAGGAGCCCCTTCCATCTGGCC
GAGATGCGGGGCTTTTCCTGCCCGGGCCGTTCATGA
 Primer design