SecReT6
Protein ID: 410471507
SecReT6 ID709
T6SS typeN/A
Gene symbol-
Locus tagBN117_0762
StrainBordetella parapertussis Bpp5
Repliconchromosome [GenBank: NC_018828] [Browse all T6SS(s) in this replicon]
Location [Strand]814655..818260 [+]
Producthypothetical protein
NoteTssM
UniProt IDK0MED6
KEGG IDbpar:BN117_0762
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.70E-99, Aligned region: 72..112
ImcF-related_N [PF14331], Evalue: 8.70E-99, Aligned region: 206..470
IcmF-related [PF06761], Evalue: 6.50E-90, Aligned region: 519..829
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 875..889
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 938..1062
Protein Sequence: 1201 a.a.     [Download]
>gi|410471507|ref|YP_006894788.1| hypothetical protein BN117_0762 [Bordetella parapertussis Bpp5]
MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLEGETARVLVIAALFAFALLRLLWRKWRE
GRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELEGRFDEAVELLRKTRFDGGGGRGWLQRYSRQYLYQLP
WYVIIGAPGSGKTTALVNSGLDFPLAERFGKAALRGVGGTRNCDWWFTDDAVLLDTAGRYTTHESDPTGD
EESWRGFLGLLTRFRGHQPINGAMLTVSIEDLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTK
ADLLAGFEQYFASFSREDLEQVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPEVLAAEPDEAR
RALAYLLPQQFAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGGETFDQVTGHLKRYLRIESGPA
PAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYRRLHWAGYGLITLAFLGLAAGWLASYGNNVRYL
DEVARRVPTVDKLGRDIKITRSGDVLGLMPFLDGLWYLPRDAAFEPDAPPLSYRFGLYQGGKMHAAMQGV
YRGTLDSVLLPQVARRIEAALRAARADDLEYGYEALRAYLMLYEADHYDAEFMHAWLLSDMQGTLPEGYT
RRQYDLMSLHLRQLAQGGVLASPFPRDEALVRQARDELARHTLAQRAYSRLRRMLAGADDQPPTTAVTLG
GPQASAVFVRKSGKPLAQGIAALYTYRGYWDVFNPRVTRVAERLRSDDAWVLDIAPPGVLDEAARQQLIV
DIKRLYLNDYVARWDGYLDDLALAPRSSLLQSIQLARTLSAPDSPLVRLTQGVARETTLLRDAGGDERSL
ADQARDRVSSTREALEQMFGPTGPGAATRADAGDGKLERVVDQHFEPWRRLARADGQGGAPIAATTSLVN
ELYTYLTAADAALRSASPAPASDVVTKLRAEAGRLPRPLRDVLDDLSTGAAGEVSGVARERLGEDLYATI
GLFCRQAIAGRYPFAPGSPRDVAPNDLARLFAPNGMMDEFFQKNLVSQIDVSEARWRFKPGMDGTPGQAS
ALLDSFQRAAAIRDAYFLAGSAEPAFRVSIRPVEMDPAITQFVMDVDGQTVRYAHGPQVATSVQWPGPRG
ANQVRIELTPQAGAAGLSASGPWALNRLLDQARVTRGASPEISLASFDIGGRKVVLEIRAGSVRSPFHLA
EMRGFSCPGRS
 
Nucleotide Sequence: 3606 bp     [Download]
>gi|410470815|ref|NC_018828.1|:814655-818260 Bordetella parapertussis Bpp5, complete genome
ATGATCCCGCGCCTGTTCGGATGGCTGTTCTCGCGCGGCCTGTGGAGCTTCCTGGGCCTGGTGGCGCTGG
CCCTGCTGGTGTGGATCGCCGGGCCGCTGCTGGCGATCGGCGCGCTGCGCCCGCTGGAAGGCGAGACCGC
GCGCGTACTGGTCATCGCCGCGCTGTTCGCCTTCGCGCTGCTGCGCCTGCTGTGGCGCAAGTGGCGCGAA
GGCCGCCTCAACGCCCAGCTGCTGGGCCAGCTGCGCCGGCCGGCCCGTCCCGAGGCCGAGGCCGCGGCCG
AGCCGCCGCCTTCGGACCTGCGCGAACTGGAAGGCCGCTTCGACGAGGCGGTGGAGCTGTTGCGCAAGAC
GCGCTTCGACGGAGGCGGCGGACGCGGCTGGCTGCAGCGCTATTCGCGCCAATACCTGTACCAGCTGCCC
TGGTACGTCATCATCGGCGCGCCAGGCTCGGGCAAGACCACGGCCCTGGTCAACTCGGGCCTGGACTTCC
CGCTGGCCGAGCGCTTCGGCAAGGCCGCGCTGCGCGGCGTGGGCGGCACCCGCAACTGCGATTGGTGGTT
CACCGACGACGCGGTGCTGCTCGATACCGCCGGCCGCTACACCACCCATGAAAGCGACCCCACCGGCGAC
GAGGAGTCCTGGCGCGGCTTTCTCGGCCTGTTGACGCGCTTTCGGGGCCACCAGCCCATCAACGGCGCCA
TGCTCACCGTCAGCATCGAGGACTTGCTGGCCGCGTCCGACGCCGAGCGCGCGCGCCACGCCGCGGTGCT
GCGCCGGCGCCTGCAGGAGCTGCGCGAGCAGCTGGGCATCCATTTCCCGGTCTATGTGCTGGTGACCAAG
GCCGACCTGCTGGCCGGCTTCGAGCAGTACTTCGCCTCGTTCAGCCGCGAAGACCTGGAGCAGGTATGGG
GCTTCACCTTGCCCTATGCGCGCGCCCAGGAGCCGGACTTCGACCTGTACGAAGCCTTTCATGCCGAGTA
CCGGCTGCTGCAGCGCCGGCTCGACGATGCCCTGCCCGAAGTGCTGGCCGCCGAGCCGGACGAGGCGCGC
CGCGCGCTGGCCTACCTGCTGCCGCAGCAGTTCGCCGGCCTGCAGGCCGTGCTGGGCCATTTCCTCAGCG
ACGTGTTCGCCAGCTCGCGCTTCGAGGAGCGCCTGGTGCCGCGCGGCGTGTACTTCACCAGCGGCACCCA
GGGCGGCGAGACCTTCGACCAGGTCACCGGCCACCTCAAGCGCTATCTGCGCATCGAAAGCGGGCCGGCC
CCGGCCGCCGCCGAGGAAGGCCGCAGCTTCTTCCTCAAGCGGCTGCTGCAGGACGTGATCTTTCCCGAGG
CCGGCCTGGCCGGCCGCAACCTGCGCTGGGAGCGCCGCTACCGCCGCCTGCACTGGGCCGGCTACGGCCT
GATCACGCTGGCGTTCCTGGGCCTGGCGGCGGGCTGGCTGGCCAGCTACGGCAACAACGTGCGCTATCTC
GACGAAGTGGCGCGCCGCGTGCCGACGGTGGACAAGCTGGGGCGCGATATCAAGATCACCCGCTCGGGCG
ATGTGCTGGGCCTGATGCCCTTCCTGGACGGCCTGTGGTACCTGCCGCGCGACGCCGCCTTCGAGCCGGA
CGCGCCGCCGCTGTCCTATCGCTTCGGGCTGTACCAGGGCGGCAAGATGCACGCCGCGATGCAGGGCGTT
TATCGCGGCACGCTCGACAGCGTCCTGCTGCCGCAGGTGGCGCGCCGCATCGAGGCGGCGCTGCGCGCGG
CCCGCGCCGACGACCTGGAGTACGGCTACGAGGCCCTGCGCGCCTACCTGATGCTGTACGAGGCCGACCA
CTACGACGCCGAGTTCATGCACGCCTGGCTGCTGTCCGACATGCAGGGCACGCTGCCCGAGGGCTACACG
CGCCGGCAGTACGACCTGATGTCGCTGCACCTGCGCCAGCTGGCGCAGGGCGGCGTGCTGGCCTCGCCGT
TTCCGCGCGACGAGGCGCTGGTGCGGCAGGCGCGCGACGAACTGGCGCGCCACACGCTGGCGCAGCGCGC
CTACAGCCGGCTGCGCCGCATGCTGGCCGGCGCCGACGATCAGCCGCCGACCACCGCGGTGACGCTGGGC
GGGCCGCAGGCCAGCGCCGTCTTCGTGCGCAAGAGCGGCAAGCCGCTGGCCCAGGGCATCGCGGCGCTGT
ACACCTACCGCGGCTATTGGGACGTGTTCAATCCGCGCGTCACGCGCGTGGCCGAGCGCCTGCGCAGCGA
CGATGCCTGGGTCCTGGACATCGCGCCGCCGGGCGTGCTGGACGAGGCTGCGCGCCAGCAGCTCATCGTC
GACATCAAGCGCCTGTACCTCAACGACTACGTGGCGCGCTGGGACGGCTACCTGGACGACCTGGCGCTGG
CGCCGCGCAGCTCGCTGCTGCAAAGCATCCAGCTGGCGCGCACCCTGTCGGCGCCCGATTCGCCGCTGGT
GCGGCTGACCCAGGGCGTGGCGCGCGAGACCACGCTGCTGCGCGACGCGGGCGGCGACGAGCGCTCGCTG
GCGGACCAGGCGCGCGACCGCGTCAGCAGCACGCGCGAGGCGCTGGAGCAGATGTTCGGCCCGACCGGCC
CGGGCGCGGCCACGCGCGCCGACGCCGGCGACGGCAAGCTGGAGCGCGTGGTCGACCAGCACTTCGAGCC
ATGGCGCAGGCTGGCGCGCGCCGACGGGCAGGGCGGCGCGCCGATTGCCGCCACCACCAGCCTGGTCAAC
GAGCTGTACACCTATCTGACGGCGGCCGACGCGGCTCTGCGCAGCGCCAGCCCGGCGCCCGCCTCCGATG
TGGTGACCAAGCTGCGCGCCGAGGCTGGCCGCCTGCCGCGGCCCTTGCGCGACGTGCTCGACGACTTGTC
CACCGGCGCGGCAGGCGAAGTGTCCGGCGTGGCGCGCGAGCGGCTGGGCGAAGACCTGTACGCCACCATC
GGCCTGTTCTGCCGCCAGGCCATCGCCGGCCGCTATCCTTTCGCGCCCGGCTCGCCGCGCGACGTCGCGC
CCAATGACCTGGCGCGGCTGTTCGCGCCCAACGGCATGATGGACGAGTTCTTCCAGAAGAACCTGGTCAG
CCAGATCGATGTGTCCGAGGCGCGCTGGCGCTTCAAGCCGGGCATGGACGGCACGCCGGGCCAGGCGTCG
GCGCTGCTGGATTCGTTCCAGCGCGCCGCCGCGATTCGCGACGCCTATTTCCTGGCCGGTAGCGCGGAGC
CGGCCTTTCGCGTCTCGATCCGTCCGGTGGAAATGGACCCGGCCATCACGCAATTCGTCATGGACGTGGA
CGGCCAGACCGTGCGCTATGCGCATGGCCCGCAGGTCGCCACCTCCGTGCAATGGCCGGGGCCGCGCGGC
GCCAACCAGGTGCGCATCGAGCTGACGCCCCAGGCCGGCGCGGCGGGCCTGTCGGCCAGCGGACCGTGGG
CGCTCAATCGCCTGCTCGACCAGGCCCGCGTCACGCGCGGCGCCTCGCCCGAGATCTCGCTGGCCAGCTT
CGATATCGGCGGCCGCAAAGTGGTGCTGGAGATCCGCGCGGGCAGCGTCAGGAGCCCCTTTCACCTGGCC
GAGATGCGGGGTTTTTCCTGCCCGGGCCGTTCATGA
 Primer design