SecReT6
Protein ID: 410480999
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04330
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]882832..884193 [+]
Producthypothetical protein
NoteTssC
UniProt IDJ9ZFU4
KEGG IDesm:O3M_04330
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-132, Aligned region: 88..414
Protein Sequence: 453 a.a.     [Download]
>gi|410480999|ref|YP_006768545.1| hypothetical protein O3M_04330 [Escherichia coli O104:H4 str. 2009EL-2050]
MLMSVQKEKNVAESVVSEAHAGDSVYASLFEKINLSPVSALSALDIWQDPQAMSEASADERLTAGMQVFM
ECLAKAGTQVEKLDKALIDHHIAELDYQISRQLDAVLHHPEFQKVESLWRGVKSLVDKTDFRRNVKIELL
DLSKDDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAALVSAWEFDASAQDVALLKNISRVAASAHM
PFIGSVGPAFFQKETMEEVAAIKDIGNHFERAEYIKWNAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHHKYLWTNASFAFAANMVRSFVTNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLVGVFLLLAMLA
SFMNNQRLVRSVGEHLTAWHRMRGYLTERQLIL
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|410480139|ref|NC_018650.1|:882832-884193 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGCTGATGTCTGTACAGAAAGAAAAGAACGTTGCAGAGAGCGTGGTATCTGAAGCGCATGCCGGCGACA
GCGTATATGCTTCCCTGTTTGAAAAAATTAACCTGAGTCCGGTATCTGCCCTGAGTGCACTGGATATCTG
GCAGGATCCACAGGCCATGTCAGAAGCATCTGCAGATGAACGTCTGACGGCAGGGATGCAGGTGTTTATG
GAGTGTCTGGCAAAAGCCGGCACGCAGGTGGAAAAACTCGATAAAGCGCTGATTGACCATCATATTGCAG
AGCTTGATTATCAGATCAGCCGTCAACTGGATGCTGTGCTTCATCATCCGGAATTTCAGAAAGTGGAGTC
GCTGTGGCGGGGCGTGAAGTCCCTGGTGGATAAAACGGACTTCCGCCGTAATGTGAAAATTGAGCTGCTG
GATCTGTCCAAAGACGATCTGCGTCAGGATTTTGAGGATGCGCCGGAAATTATTCAGAGCGGCCTTTATC
TGCAGACCTATGTGGCTGAGTATGACACGCCGGGTGGTGAGCCCATTGCCGCCCTGGTTTCAGCCTGGGA
GTTTGATGCATCTGCACAGGACGTGGCGTTGCTGAAAAATATTTCCCGGGTGGCGGCATCTGCACATATG
CCGTTTATTGGTTCAGTTGGCCCGGCGTTCTTCCAGAAAGAAACCATGGAAGAGGTGGCTGCCATCAAGG
ATATTGGCAACCACTTTGAGCGTGCCGAGTACATCAAGTGGAATGCTTTCCGTGAGACGGACGATGCCCG
CTATATTGGCCTGGTGATGCCCCGTGTACTGGGACGCCTGCCGTATGGCCCGGATACCGTACCTGTCCGC
AGCTTTAACTATGTTGAAGAGGTGAAAGGACCGGACCACCATAAATATCTCTGGACGAACGCGTCTTTTG
CCTTTGCAGCCAACATGGTGCGCAGTTTTGTCACCAACGGCTGGTGTGTTCAGATCCGTGGGCCTCAGGC
CGGTGGTGCGGTGCAGGATTTGCCAATCCATTTGTATGATCTGGGAACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACGCGGGAGTTTGAATTCGCGAATCTGGGCTTTATTCCGCTCTCTTACT
ACAAGAACCGGGATTATGCCTGCTTCTTCTCTGCTAACTCCGCCCAGAAACCGGCGCTGTACGATACGCC
GGATGCAACGGCGAACAGTCGTATTAATGCCCGTCTTGTCGGTGTTTTTCTTCTGCTGGCTATGCTGGCG
TCTTTTATGAATAACCAGCGGCTGGTTCGCAGCGTGGGGGAACACCTGACGGCCTGGCACCGGATGCGCG
GATATCTGACAGAACGTCAGTTAATCCTGTAG
 Primer design

Protein ID: 410481010
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04405
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]892780..894258 [+]
Producthypothetical protein
NoteTssC
UniProt IDJ9ZHM7
KEGG IDesm:O3M_04405
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-177, Aligned region: 65..488
Protein Sequence: 492 a.a.     [Download]
>gi|410481010|ref|YP_006768556.1| hypothetical protein O3M_04405 [Escherichia coli O104:H4 str. 2009EL-2050]
MTVASTLGLNETQYATDDCLEEIINNTRAVRQDSEKTRFKLQINNFLAEVASGSLVINSDLIGSIEKRIA
DIDKLMSEQLSLIMHATEFQKIESAWTGLYKLVQASVTENVKYTVLHCTKKELLKDFKSASDFDQSVLFK
NIYESEYGTFGGTPYSAFVGDFYFDNTPQDIDLLEHISHVAASAHAPFLSAIAPGMLSMSSFSELPYPRD
LAKLFETTDYARWRSFRQTDDSRYVGLTLPQSLGRIPYGMKTIPAETFNFEEHISEDNSGKDYLWVNTAF
ELACRIVDAFEEYGWCAAIRGVEGGGLVKSLPAYNYVSHTGERLLQCPTEVAISDRREKELSDLGFIPLV
YCKGTDFAAFFAVQSVNKARLYNTDQANANAKLSSQLQYILATSRFAHYLKVIVRDKVGSFMSRTECQTY
LQNWIMQYVVASDNAGQETKARYPLREASVEVIEVPGSPGNYRAIAWIKPHFQLEGLSMSLRLVADLPSS
VS
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|410480139|ref|NC_018650.1|:892780-894258 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGACAGTTGCATCAACATTAGGGCTGAATGAAACTCAGTATGCTACAGATGATTGTCTTGAAGAGATTA
TAAATAATACCAGAGCTGTGAGACAGGATTCTGAAAAGACCAGGTTTAAACTACAGATTAATAATTTCCT
TGCTGAAGTTGCCAGTGGTTCTTTGGTCATTAACAGCGATTTAATCGGTAGTATTGAAAAGCGGATTGCT
GATATTGATAAGTTGATGTCTGAGCAGCTTAGTCTGATTATGCATGCGACTGAATTTCAAAAAATAGAAT
CAGCATGGACGGGACTTTATAAGCTGGTTCAGGCCAGCGTTACTGAAAATGTAAAATACACGGTGTTACA
CTGTACTAAAAAGGAATTGCTCAAAGACTTCAAGTCAGCCTCAGATTTCGATCAGTCTGTCTTATTTAAG
AATATTTATGAAAGCGAGTATGGAACGTTCGGGGGAACACCGTATTCTGCTTTTGTTGGTGATTTCTATT
TTGATAATACACCGCAGGATATTGATTTGCTGGAGCATATTTCCCATGTTGCTGCCAGTGCTCATGCCCC
GTTTCTGAGTGCTATTGCTCCGGGTATGTTGTCCATGAGTTCATTTAGCGAATTACCCTACCCGCGTGAT
CTGGCAAAATTGTTTGAGACAACAGATTATGCCCGTTGGCGTAGTTTCAGGCAGACAGATGACAGTCGTT
ATGTGGGATTGACTTTGCCACAGTCTCTGGGGCGTATTCCATATGGCATGAAGACTATACCTGCCGAAAC
GTTTAATTTTGAAGAGCACATTAGTGAAGATAACTCAGGCAAAGACTATCTGTGGGTAAATACAGCTTTT
GAACTTGCCTGCCGGATAGTTGATGCTTTTGAGGAGTATGGCTGGTGTGCAGCAATTCGGGGCGTGGAAG
GTGGCGGTTTGGTTAAATCATTGCCGGCCTATAATTATGTATCCCATACAGGTGAGCGACTTTTACAATG
TCCGACGGAGGTTGCTATCTCAGACCGTCGGGAAAAAGAATTGTCAGATCTCGGTTTTATTCCTCTGGTT
TATTGTAAAGGTACTGATTTTGCGGCATTTTTCGCTGTTCAGTCGGTAAACAAAGCACGACTGTATAATA
CTGATCAGGCTAATGCGAATGCAAAATTATCCAGTCAGCTTCAGTATATATTAGCAACATCACGATTCGC
ACATTATCTTAAAGTGATTGTTCGTGACAAAGTTGGAAGCTTTATGTCGAGGACAGAATGTCAGACATAT
CTGCAAAACTGGATCATGCAATATGTTGTGGCATCAGATAACGCTGGTCAGGAGACAAAGGCTCGTTATC
CATTACGTGAGGCATCTGTTGAAGTTATTGAAGTCCCTGGAAGTCCGGGAAATTATCGTGCAATTGCATG
GATTAAACCTCATTTTCAGCTTGAGGGTTTAAGTATGTCATTGCGTCTTGTTGCTGATTTACCATCAAGT
GTAAGTTAA
 Primer design