SecReT6
Protein ID: 410481009
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04400
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]892301..892777 [+]
Producthypothetical protein
NoteTssB
UniProt IDJ9ZFV1
KEGG IDesm:O3M_04400
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-45, Aligned region: 8..146
Protein Sequence: 158 a.a.     [Download]
>gi|410481009|ref|YP_006768555.1| hypothetical protein O3M_04400 [Escherichia coli O104:H4 str. 2009EL-2050]
MSNTQHKLDKTRPPRVQITYDVETGDAETAKELPLVIGVLGEYSSSEKPLRERKFISIDKDNFDEVMASM
SPTAHFMVDSVIPGNEGKLDVELRFSCKDDFSPDNVIQQVECLRKLSELRLHLCDLRNRAASNEKLKEKL
QELLVTTNGNPENDESKE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|410480139|ref|NC_018650.1|:892301-892777 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGAGCAATACACAACATAAACTTGATAAAACCCGCCCCCCACGAGTACAGATAACGTATGATGTTGAAA
CCGGAGATGCTGAAACTGCGAAAGAGTTACCCCTTGTCATCGGGGTTTTGGGTGAGTACTCTTCGTCAGA
AAAACCATTGAGAGAACGAAAATTCATTAGTATAGATAAAGACAATTTTGATGAAGTTATGGCATCAATG
AGTCCGACTGCTCATTTTATGGTGGACAGTGTTATCCCGGGAAATGAAGGAAAACTGGATGTCGAACTGA
GGTTTAGTTGCAAAGATGATTTTTCTCCCGATAATGTGATTCAACAGGTTGAGTGTCTAAGAAAATTATC
GGAATTGAGGTTGCATCTTTGTGACCTACGAAACAGGGCTGCAAGTAATGAGAAACTGAAAGAAAAACTT
CAGGAATTGCTGGTGACTACTAATGGCAATCCTGAAAACGATGAAAGTAAGGAATAA
 Primer design