SecReT6
Protein ID: 410481012
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04415
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]894784..895206 [+]
Producthypothetical protein
NoteTssE
UniProt IDJ9ZHQ5
KEGG IDesm:O3M_04415
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-06, Aligned region: 26..118
Protein Sequence: 140 a.a.     [Download]
>gi|410481012|ref|YP_006768558.1| hypothetical protein O3M_04415 [Escherichia coli O104:H4 str. 2009EL-2050]
MHSFLQFLRDDNPGSLEDHLNFVPSDDLKYELGMLLSSRPLYLETDELPFVNSSVLNYGIKSSVYVVSAG
EHSDSVNDEISSRILMMLQRYESRLEEPVVEYLSSDDNYSFFSVTALFFMDMVRLCIKWDKNSGEFSLDE
 
Nucleotide Sequence: 423 bp     [Download]
>gi|410480139|ref|NC_018650.1|:894784-895206 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGCATTCGTTTCTTCAGTTCTTACGTGATGATAATCCGGGCTCTCTGGAAGATCATCTGAATTTTGTTC
CTTCAGATGATCTGAAATATGAGCTCGGGATGTTATTATCATCACGACCTTTATACCTTGAAACAGATGA
GCTGCCGTTTGTTAATAGTTCTGTCCTGAACTATGGCATAAAGTCATCAGTATATGTAGTTTCTGCAGGT
GAACATAGTGATTCTGTTAATGATGAAATTTCTTCAAGAATATTGATGATGCTCCAGCGTTATGAGTCCC
GGCTGGAGGAACCAGTTGTTGAATATCTTTCCAGTGATGATAATTATTCTTTCTTTTCAGTTACAGCCCT
GTTCTTTATGGACATGGTAAGACTCTGTATTAAATGGGATAAGAACTCAGGAGAATTTTCACTGGATGAA
TAA
 Primer design