SecReT6
Protein ID: 410481014
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04425
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]895670..897001 [+]
Producthypothetical protein
NoteTssF
UniProt IDJ9ZFV7
KEGG IDesm:O3M_04425
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-80, Aligned region: 9..440
Protein Sequence: 443 a.a.     [Download]
>gi|410481014|ref|YP_006768560.1| hypothetical protein O3M_04425 [Escherichia coli O104:H4 str. 2009EL-2050]
MNLDVFDGANFSLDFVRFYLNGPATVTGIIYTLLCDEVDNIVLQRNNDVLYDISANISGAGFYESEVTLP
QKGNVSYIHNLILDYFSFPERFNFIDIEFDSGIELCSGDSVRIEITLKSSAEKYEPDRIERNVSERLFKV
NCSPVVNLFEKKTEPLRLSDGQDEYQVNTDLYSRNEVLIWDINKVTLHRYENDIVKQFPLKNLFGLEHSV
IKQSCNIFWHSSCYRSSSERGNFEESVYIRLSDDGGAQSCIMTGDVLSIDAICTNGNIPSSINNGDPDGD
FDCDIDIAQLRITALNRPSRMLPAMALKGMNWRIVSQLSLNFVLLSGTDGAMKLREMLSIYNYNNNHSIS
IFIEWIKELQITPVSSRLPGIYPPVTARGIDITVTLSKDADMHPECFMFCSFLDHFLGLHAPVNSFTRMI
TVIEHEEHTRRVWPIRAGKLTWL
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|410480139|ref|NC_018650.1|:895670-897001 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
TTGAATTTAGACGTTTTCGACGGAGCTAATTTTTCTCTTGATTTTGTAAGATTTTATTTGAATGGTCCGG
CAACGGTTACTGGTATAATATATACATTATTGTGCGATGAGGTCGATAATATCGTTTTGCAGAGAAATAA
TGATGTGTTATATGATATCAGTGCTAATATATCCGGTGCCGGATTTTATGAGAGTGAAGTAACACTTCCA
CAAAAAGGGAACGTTTCTTATATACATAACCTCATACTGGACTATTTTTCTTTTCCAGAACGATTTAACT
TCATTGATATAGAATTTGACTCCGGAATCGAATTATGCTCAGGGGATTCTGTGAGAATAGAAATAACATT
AAAAAGCAGTGCAGAAAAGTATGAGCCAGACAGAATAGAAAGGAATGTTTCTGAAAGACTTTTTAAAGTA
AACTGTTCTCCCGTTGTCAATCTCTTCGAGAAGAAAACTGAACCCCTACGATTATCTGATGGCCAGGATG
AGTATCAGGTAAATACCGATTTATATTCACGTAATGAAGTCTTAATCTGGGATATAAATAAAGTGACATT
GCACAGATATGAAAATGATATAGTCAAGCAGTTTCCGTTAAAAAATTTATTTGGACTTGAACATTCTGTC
ATTAAACAATCGTGCAATATATTCTGGCATAGTTCATGTTATCGCTCGTCTTCTGAAAGAGGGAACTTTG
AGGAAAGTGTATATATTCGTCTGAGCGATGATGGCGGAGCCCAGTCATGTATCATGACTGGGGATGTCCT
TTCAATTGATGCAATATGTACAAATGGTAATATTCCATCATCAATTAATAATGGTGATCCTGATGGTGAT
TTTGATTGTGATATAGATATTGCTCAGCTGCGAATAACTGCGCTGAACCGTCCATCAAGAATGTTGCCGG
CTATGGCATTAAAAGGAATGAACTGGAGAATTGTTTCTCAGTTATCCCTTAATTTTGTGTTGCTCAGTGG
TACTGATGGGGCAATGAAACTGAGAGAAATGCTATCCATATATAACTACAACAATAACCACTCAATATCA
ATTTTTATTGAATGGATTAAAGAGTTACAAATCACACCAGTTTCATCCCGTTTACCCGGCATATATCCGC
CTGTAACTGCTCGTGGAATTGATATTACCGTAACTCTTTCAAAGGATGCAGATATGCACCCTGAATGTTT
CATGTTTTGCTCTTTCCTTGATCACTTTCTTGGGCTACATGCCCCTGTCAATAGCTTTACTCGCATGATT
ACTGTCATTGAACATGAGGAGCACACTCGTCGTGTATGGCCGATAAGAGCAGGAAAGTTAACATGGCTTT
GA
 Primer design