SecReT6
Protein ID: 410481015
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04430
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]896992..897924 [+]
Producthypothetical protein
NoteTssG
UniProt IDJ9ZHN4
KEGG IDesm:O3M_04430
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.10E-54, Aligned region: 7..296
Protein Sequence: 310 a.a.     [Download]
>gi|410481015|ref|YP_006768561.1| hypothetical protein O3M_04430 [Escherichia coli O104:H4 str. 2009EL-2050]
MALINNRSKFSFFNKVRVLLKNILKPDESVEDVVDEHFRFTSSLSLDAPDGQIENLYQDEKDGKYHLTLF
DNGLTGATGVLPAAYTEWLIERKLRYNDDAPKAFMDMFDHRMYCLSYLAWQKMHLSGDENRRDNNVLNNV
LLSLGGITPQTVSVTGLAYVAFYSQPVRSLAGLEQLLSLIHQIRVSINPFRGTFENTEPSEQGVLGNCLY
TLGEGPVIGNVRWVVDSHFDVVLGPVDYRKAQELMPGKDSHYFIRQQIRSYIGDVLKFKIYVKIYPGNND
NQLNINNKLGFNLSLGSETENYKERCFCIF
 
Nucleotide Sequence: 933 bp     [Download]
>gi|410480139|ref|NC_018650.1|:896992-897924 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGGCTTTGATTAATAACCGGAGTAAATTCAGCTTTTTCAATAAAGTCCGTGTGTTATTGAAAAATATTC
TGAAACCAGATGAAAGCGTTGAAGACGTTGTTGATGAACATTTCAGATTTACATCAAGTCTGTCTTTAGA
TGCACCTGACGGTCAGATAGAGAATCTGTATCAGGATGAGAAGGACGGAAAGTATCATCTCACATTATTC
GATAATGGATTAACCGGGGCTACAGGGGTTCTTCCTGCCGCATATACAGAATGGCTGATTGAAAGGAAAT
TACGTTATAATGACGACGCTCCTAAGGCATTCATGGACATGTTTGACCATAGAATGTATTGTCTTTCTTA
TCTCGCATGGCAAAAAATGCATCTGTCAGGAGATGAAAACAGAAGGGATAATAATGTTCTTAACAATGTT
CTTTTATCTTTAGGCGGGATCACCCCTCAGACAGTTAGTGTGACAGGTCTGGCATACGTTGCATTCTATT
CACAACCAGTAAGATCCCTGGCCGGGCTTGAGCAGTTACTCTCGTTAATACATCAAATCAGAGTGTCCAT
TAATCCTTTTCGTGGCACTTTTGAAAATACAGAACCCAGTGAGCAGGGGGTTCTGGGGAATTGCCTCTAT
ACTCTGGGGGAAGGTCCTGTCATAGGCAATGTTCGTTGGGTGGTTGATTCACATTTTGATGTTGTATTGG
GGCCTGTGGACTATAGAAAAGCACAGGAACTTATGCCGGGAAAAGATTCCCACTATTTTATCAGACAACA
AATAAGATCGTATATAGGTGATGTTCTTAAGTTCAAAATATATGTGAAAATCTATCCCGGTAACAATGAT
AATCAACTTAATATAAACAATAAGCTTGGTTTCAATCTTTCACTCGGTTCTGAAACAGAAAATTATAAAG
AACGGTGCTTTTGTATATTTTGA
 Primer design