SecReT6
Protein ID: 410481018
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04445
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]900401..900706 [+]
Producthypothetical protein
NotePAAR
UniProt IDJ9ZGX6
KEGG IDesm:O3M_04445
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.00E-20, Aligned region: 3..19
PAAR_motif [PF05488], Evalue: 2.00E-20, Aligned region: 26..94
DUF4150 [PF13665], Evalue: 2.20E-05, Aligned region: 36..53
DUF4150 [PF13665], Evalue: 2.20E-05, Aligned region: 59..87
Protein Sequence: 101 a.a.     [Download]
>gi|410481018|ref|YP_006768564.1| hypothetical protein O3M_04445 [Escherichia coli O104:H4 str. 2009EL-2050]
MYMPQPAARVTDMHVCPMVTPGLPPVPHVGGPLLPPGSPSVFIGGLPAATLGTLALCSGPVDVVIMGSVK
VLICGKPAARMGDICAHGGTIVSGYPQVLIG
 
Nucleotide Sequence: 306 bp     [Download]
>gi|410480139|ref|NC_018650.1|:900401-900706 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
TTGTATATGCCTCAACCTGCTGCAAGAGTTACTGATATGCATGTATGTCCTATGGTGACGCCTGGTTTAC
CACCTGTTCCCCATGTTGGGGGGCCATTGTTACCACCAGGCTCTCCGTCTGTATTTATTGGTGGATTACC
GGCAGCGACATTGGGGACCCTGGCTCTTTGTTCTGGGCCAGTGGATGTTGTCATTATGGGAAGTGTTAAG
GTCTTGATATGCGGCAAACCAGCTGCACGAATGGGCGATATCTGTGCTCACGGAGGGACAATTGTCAGTG
GATATCCTCAGGTATTAATAGGATGA
 Primer design