SecReT6
Protein ID: 410481019
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04450
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]900710..901786 [+]
Producthypothetical protein
NoteTssA
UniProt IDJ9ZFW1
KEGG IDesm:O3M_04450
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-22, Aligned region: 57..117
Protein Sequence: 358 a.a.     [Download]
>gi|410481019|ref|YP_006768565.1| hypothetical protein O3M_04450 [Escherichia coli O104:H4 str. 2009EL-2050]
MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRKVRKLCEVTLR
NKSKDLQISCWYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEGQEIRYSKLVRLDIDLSEYLK
AYPLLEDKEITLSEWYKVLSFEHGASLSEAGKERLIESEGDHSVESFKRAVGKYNPRKVSEQLLQLYDLP
DKIDEIESSYFFHTHEDIHHIFAKTRHIISEITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEK
KEFYSALTPSTDKEMSREKAIEQLEKIAIFFRQSEPTSPVPYLLERAIRWSTMTMSEWLEELLKDNDSME
QINRVLKG
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|410480139|ref|NC_018650.1|:900710-901786 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGAACAAAATAGAAACGGATACATTACTGCTTCCTGTTATAGGAGAATCGCCGGCAGGTGATGATATTG
AGTATGATCCGGTGTATAGCGAAATACGGGAGGCAAGACAAAATGATCCGGACTATATGTCTCAGGGGGA
ATGGGCTGTCAGTGAACCCCGCAGAGCTGACTGGAGAAAAGTAAGAAAATTATGTGAGGTTACTTTACGT
AATAAGAGTAAGGACCTACAAATTAGTTGCTGGTATGTGGAGTCCTTGACGCATTTATATGCTCTGGAAG
GGATGCATTGCGGATTGGAATATCTTGCAAAGTTTATTTCTCAGTACTGGACTACATGCTGGCCATCGCA
GGAAGAAGGTCAGGAAATTCGTTACAGTAAATTGGTTCGTCTTGATATAGATTTATCAGAGTATCTGAAA
GCATATCCTCTTCTTGAGGATAAGGAAATCACACTTTCTGAATGGTATAAGGTGTTATCGTTTGAACATG
GAGCAAGTTTGTCAGAAGCTGGAAAAGAAAGATTAATAGAGAGCGAAGGTGATCACTCTGTTGAGTCCTT
CAAAAGAGCTGTAGGAAAATATAATCCCCGCAAGGTTAGTGAGCAACTTCTCCAGCTTTATGATCTACCT
GACAAAATTGATGAGATTGAATCTTCTTACTTCTTTCATACGCATGAAGATATACATCATATTTTCGCAA
AAACCAGACATATCATCAGTGAGATAACCGAGTTACTGAGTCGTTTTTTGCCGCAAGAAACACTGGATCA
CAGTTCAGTTTCTCAATTTCTAGGCAAACCCGATAGCAGAGACACAAGGACAGCACTTCCTGAGGAAAAA
AAGGAATTTTATTCTGCATTAACACCCTCAACAGATAAAGAGATGTCAAGGGAGAAAGCTATAGAGCAAC
TGGAGAAAATAGCTATTTTTTTCAGGCAATCTGAACCAACCAGTCCTGTTCCTTATCTTCTGGAGAGGGC
CATACGTTGGTCAACAATGACTATGTCAGAATGGCTTGAGGAACTACTTAAAGATAATGACTCTATGGAA
CAAATAAACCGTGTCTTAAAAGGATGA
 Primer design