SecReT6
Protein ID: 410481020
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04455
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]901794..902345 [+]
Producthypothetical protein
NoteTssJ
UniProt IDJ9ZHP2
KEGG IDesm:O3M_04455
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.10E-18, Aligned region: 15..152
Protein Sequence: 183 a.a.     [Download]
>gi|410481020|ref|YP_006768566.1| hypothetical protein O3M_04455 [Escherichia coli O104:H4 str. 2009EL-2050]
MTIKCLLLAVMVFPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLFL
QASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHIDRNEGTKYVGVIAGYYPFPGK
QHMLLLDIPVDVVEEGWWNKSLHASLLPLSKKISMGKESISMK
 
Nucleotide Sequence: 552 bp     [Download]
>gi|410480139|ref|NC_018650.1|:901794-902345 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGACTATTAAGTGCCTGCTACTAGCGGTTATGGTATTCCCCTTTTTCATCACTGCCTGTTCTGATAAGT
ATTCTGAACAGGATAGAGTGCAGGCTATCAACAATGCCGATGCTCCATTTGGCGCCGGCTTGCTTACTTT
TCAGATATCATCTGATACGCAATTAAACTCACTTAACGAGATATCCAACAGCTGTGCATTATTATTCTTA
CAGGCTTCAGATAAAAATACATTACAGGACATAATGAATAATCCTGTGTTAATCAAACAGTTTTTTATCG
GGACAGGTAAGGTTGATGGCATTCTTAAAGTTGATAAATACGTGGCTATGCCGGGGCAGGAGATAACGCT
ACATATAGACAGGAATGAAGGGACTAAATATGTAGGTGTGATTGCTGGATACTATCCATTTCCTGGAAAA
CAGCATATGTTACTCTTAGATATTCCGGTTGATGTTGTTGAGGAAGGTTGGTGGAACAAATCATTACATG
CATCACTCTTACCTCTTTCCAAAAAGATATCGATGGGTAAAGAAAGTATCAGTATGAAATAA
 Primer design