SecReT6
Protein ID: 410481021
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04460
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]902364..903776 [+]
Producthypothetical protein
NoteTssK
UniProt IDJ9ZIV0
KEGG IDesm:O3M_04460
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-64, Aligned region: 20..446
Protein Sequence: 470 a.a.     [Download]
>gi|410481021|ref|YP_006768567.1| hypothetical protein O3M_04460 [Escherichia coli O104:H4 str. 2009EL-2050]
MQEEEQLVYWYSGLYLQPQHFQSIDLHHGFMLARSRQLSQPHHQGYYECCINDDLLKEDTVRVEKIKAVL
SSGYYIEYPGNCVVQDKCLTNLKGSDHGTVDLWLALKRFNSGHKNVSSVNDKRGSARWISSDDERNMRNV
YHDSQDADITRIKYDIQILTDEEKDNTTDYEYLPLTRIIYGNNSLCIDDECSFPVMRLSANHKLRNKIAE
IYSDIKFYKNRLEKYRYTERTVSDGHLYNFLILCAINRTLPLLSSFINEDAIHPWLYYMALCQFAGEIST
FHNSGLSDTRIVELSYNHYEQISCFSDLQYYIKLILDDSCRDKIISVEFRKITTDTLICNFDEYGAGSNS
DYYIKLTSDTFRKNKLIALPEIKIAPSEHIDMIIQHALPGIKFTVMDAVTSDLQVRENTIWLKIDKHSEL
WTLAQTQKRVAFYWSCSPDDLLVELVLSQEKYAVSRPKQDNGSFHPAVGR
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|410480139|ref|NC_018650.1|:902364-903776 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGCAAGAAGAAGAACAACTTGTTTATTGGTATTCAGGGCTCTATTTACAACCTCAGCACTTTCAGTCAA
TTGACTTGCATCATGGCTTCATGCTTGCCAGAAGCAGGCAGTTATCACAACCCCATCATCAGGGGTACTA
TGAATGTTGTATCAATGATGATCTTCTTAAGGAAGATACTGTCAGAGTTGAAAAAATAAAGGCTGTTTTA
TCTTCAGGGTATTATATCGAGTATCCGGGTAACTGTGTGGTACAGGATAAGTGCCTGACAAATCTCAAAG
GTTCAGATCACGGTACCGTGGATTTGTGGCTTGCGCTTAAGAGATTCAATTCCGGTCATAAAAATGTCTC
CAGTGTTAATGATAAACGAGGCTCTGCCAGATGGATAAGTTCAGATGATGAACGTAACATGCGTAATGTT
TATCATGACAGTCAGGATGCCGATATTACAAGAATAAAATATGATATTCAGATTCTTACAGATGAGGAAA
AAGATAATACTACAGACTATGAGTATTTACCCCTGACAAGGATCATATATGGAAATAATTCATTATGTAT
TGATGATGAGTGTTCATTTCCCGTGATGAGGTTATCTGCGAATCACAAACTTAGAAATAAGATCGCAGAG
ATCTATTCGGATATTAAGTTCTACAAAAATAGACTGGAGAAATACAGATATACAGAACGAACAGTGTCCG
ATGGACATCTTTATAACTTTTTAATTCTATGTGCTATTAATAGGACATTACCACTTCTTTCTTCATTCAT
TAATGAAGATGCCATTCACCCATGGTTGTATTATATGGCATTATGTCAGTTTGCAGGGGAAATATCTACA
TTTCATAACTCTGGACTTTCAGATACTAGGATTGTCGAACTATCATACAATCATTATGAGCAGATCTCAT
GTTTCAGTGATCTGCAGTATTATATTAAGTTAATACTGGATGATTCATGTCGAGATAAGATTATTAGTGT
TGAATTCAGAAAAATAACTACTGATACATTGATCTGTAATTTCGATGAGTACGGTGCCGGAAGTAATTCA
GATTACTATATTAAGTTAACCTCAGATACCTTCAGAAAGAATAAGCTGATTGCATTGCCAGAGATTAAGA
TTGCTCCATCTGAACATATCGACATGATAATTCAGCATGCTCTTCCAGGAATCAAGTTTACAGTGATGGA
TGCCGTTACATCTGATTTGCAGGTAAGAGAGAATACAATCTGGTTAAAGATAGATAAACATTCAGAATTA
TGGACGTTAGCTCAGACTCAAAAAAGAGTTGCATTCTATTGGTCATGTAGTCCTGATGATTTACTTGTAG
AGTTAGTATTATCGCAGGAAAAGTATGCCGTAAGCAGGCCTAAACAGGATAACGGTTCTTTCCATCCGGC
GGTTGGCAGATAA
 Primer design