SecReT6
Protein ID: 410481023
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04470
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]904115..904705 [+]
Producthypothetical protein
NoteTssL
UniProt IDJ9ZGY3
KEGG IDesm:O3M_04470
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-29, Aligned region: 1..194
Protein Sequence: 196 a.a.     [Download]
>gi|410481023|ref|YP_006768569.1| hypothetical protein O3M_04470 [Escherichia coli O104:H4 str. 2009EL-2050]
MNIVECYMPVFKLISSVRVFPEEYSDYDSTRKNIINTVEEAVRNSEKMSLSDSELDAAFYAVIVMLDEAI
LCSELPCRKEWRDNLLQIKYFGHSTGGVEFFYKLDKVIESGSQAGWVFLLCLLLGFRGKYSVGSNDEINN
YISRLRRQCELNVAIDEGNNISLRKKKYKSSRLGFYLLLVGIVAVYFVVLSMIYMR
 
Nucleotide Sequence: 591 bp     [Download]
>gi|410480139|ref|NC_018650.1|:904115-904705 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
GTGAATATTGTTGAATGCTATATGCCAGTATTTAAACTCATATCATCTGTCAGAGTTTTCCCTGAAGAAT
ATAGTGATTACGACAGTACTAGAAAGAATATAATTAACACTGTTGAGGAGGCTGTTCGCAATAGTGAAAA
AATGTCGTTGAGTGACAGCGAACTTGATGCGGCATTTTATGCTGTAATCGTCATGCTTGATGAGGCAATA
TTGTGTTCAGAGCTTCCCTGTAGAAAAGAATGGCGTGATAATCTTTTGCAGATAAAATATTTCGGACACT
CCACTGGGGGGGTCGAGTTCTTTTATAAACTTGATAAAGTCATCGAATCGGGAAGTCAGGCTGGATGGGT
CTTTCTCCTGTGCCTGTTACTGGGTTTCAGAGGTAAATATTCCGTGGGTAGTAATGATGAAATCAATAAT
TATATATCGAGGCTGAGGCGACAATGTGAATTGAATGTTGCAATCGACGAAGGAAACAATATTTCACTCA
GGAAAAAAAAGTATAAATCATCGAGGCTTGGTTTCTATTTATTACTTGTAGGTATTGTTGCTGTCTATTT
TGTGGTTTTATCCATGATTTATATGAGATGA
 Primer design