SecReT6
Protein ID: 410481025
SecReT6 ID699
T6SS typei4b
Gene symbol-
Locus tagO3M_04480
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]908119..910668 [+]
Producthypothetical protein
NoteTssH
UniProt IDJ9ZHP9
KEGG IDesm:O3M_04480
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-41, Aligned region: 213..289
AAA_2 [PF07724], Evalue: 1.50E-41, Aligned region: 577..740
AAA [PF00004], Evalue: 1.10E-18, Aligned region: 213..325
AAA [PF00004], Evalue: 1.10E-18, Aligned region: 582..666
AAA_5 [PF07728], Evalue: 3.30E-12, Aligned region: 213..233
AAA_5 [PF07728], Evalue: 3.30E-12, Aligned region: 581..699
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 190..234
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 252..291
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 459..474
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 579..626
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 650..669
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 787..825
ClpB_D2-small [PF10431], Evalue: 2.90E-10, Aligned region: 747..821
AAA_22 [PF13401], Evalue: 6.20E-10, Aligned region: 212..326
AAA_22 [PF13401], Evalue: 6.20E-10, Aligned region: 579..675
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 207..230
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 576..700
IstB_IS21 [PF01695], Evalue: 3.20E-07, Aligned region: 194..274
IstB_IS21 [PF01695], Evalue: 3.20E-07, Aligned region: 581..600
AAA_17 [PF13207], Evalue: 9.00E-07, Aligned region: 213..255
AAA_17 [PF13207], Evalue: 9.00E-07, Aligned region: 581..604
AAA_25 [PF13481], Evalue: 1.00E-06, Aligned region: 195..239
AAA_25 [PF13481], Evalue: 1.00E-06, Aligned region: 576..600
AAA_25 [PF13481], Evalue: 1.00E-06, Aligned region: 700..747
AAA_18 [PF13238], Evalue: 2.40E-06, Aligned region: 213..247
AAA_18 [PF13238], Evalue: 2.40E-06, Aligned region: 582..600
AAA_19 [PF13245], Evalue: 6.40E-06, Aligned region: 213..230
AAA_19 [PF13245], Evalue: 6.40E-06, Aligned region: 577..603
AAA_29 [PF13555], Evalue: 1.20E-05, Aligned region: 205..229
AAA_29 [PF13555], Evalue: 1.20E-05, Aligned region: 575..604
AAA_14 [PF13173], Evalue: 1.30E-05, Aligned region: 213..321
AAA_14 [PF13173], Evalue: 1.30E-05, Aligned region: 579..662
Zeta_toxin [PF06414], Evalue: 1.40E-05, Aligned region: 213..233
Zeta_toxin [PF06414], Evalue: 1.40E-05, Aligned region: 580..631
T2SE [PF00437], Evalue: 3.50E-05, Aligned region: 195..230
T2SE [PF00437], Evalue: 3.50E-05, Aligned region: 361..407
T2SE [PF00437], Evalue: 3.50E-05, Aligned region: 570..613
AAA_23 [PF13476], Evalue: 4.40E-05, Aligned region: 213..468
AAA_23 [PF13476], Evalue: 4.40E-05, Aligned region: 578..608
DUF815 [PF05673], Evalue: 9.90E-05, Aligned region: 207..252
DUF815 [PF05673], Evalue: 9.90E-05, Aligned region: 581..622
AAA_30 [PF13604], Evalue: 0.00029, Aligned region: 206..240
AAA_30 [PF13604], Evalue: 0.00029, Aligned region: 576..613
RNA_helicase [PF00910], Evalue: 0.00045, Aligned region: 214..234
RNA_helicase [PF00910], Evalue: 0.00045, Aligned region: 582..603
RNA_helicase [PF00910], Evalue: 0.00045, Aligned region: 681..700
ABC_tran [PF00005], Evalue: 0.00061, Aligned region: 213..232
ABC_tran [PF00005], Evalue: 0.00061, Aligned region: 575..619
NACHT [PF05729], Evalue: 0.00066, Aligned region: 213..240
NACHT [PF05729], Evalue: 0.00066, Aligned region: 406..452
NACHT [PF05729], Evalue: 0.00066, Aligned region: 581..599
Mg_chelatase [PF01078], Evalue: 0.0023, Aligned region: 210..251
Mg_chelatase [PF01078], Evalue: 0.0023, Aligned region: 356..386
Mg_chelatase [PF01078], Evalue: 0.0023, Aligned region: 581..602
DUF258 [PF03193], Evalue: 0.0034, Aligned region: 208..232
DUF258 [PF03193], Evalue: 0.0034, Aligned region: 570..598
AAA_11 [PF13086], Evalue: 0.0057, Aligned region: 212..469
AAA_11 [PF13086], Evalue: 0.0057, Aligned region: 570..602
Arch_ATPase [PF01637], Evalue: 0.0092, Aligned region: 192..227
Arch_ATPase [PF01637], Evalue: 0.0092, Aligned region: 265..361
Arch_ATPase [PF01637], Evalue: 0.0092, Aligned region: 578..600
Protein Sequence: 849 a.a.     [Download]
>gi|410481025|ref|YP_006768571.1| hypothetical protein O3M_04480 [Escherichia coli O104:H4 str. 2009EL-2050]
MSIYLKPIINKLAPESRNTLDSAINYAISRSHHEVDCLHLLWKLLQEHKYIAEVLYEQSLFNPERVLNAI
ESELIRINTVPQSSPVFSESMQTLLEKTWIHASTKWQIDHIDIPVFLSTMINLRDSIFPLNVSDALCCDM
DVAEELLISFSDEAEHSASHRPTDRSSHEYLSKYTENLSLRAETGKLDPVTGREKEVRQLIDILLRRRQN
NPILTGEPGVGKSSIVEGLALQIASGRVPDVLKNVRIHALDMGALLAGASVRGEFENRLKSLLTELNSLD
GTAILFIDEAHSLIGAGGLPGQTDAANLLKPALARGELRIIAATTWGEYKKYFEKDGALARRFQIVKVAE
PNQDVTAEMLRSLLPMMEKHHNVSIREEAITATVHLSDRYLHGRRQPDKSVSLLDTACSRVAVSQSTSPD
AIQDVEASLVRYQGELALLTQERSDVLRQEMLANKIAQLEEELEQLKSAWRHQSELVARIQSSDDISSKN
MYRKELESAYKKDSPMVFECVDKNCVADVVSGWTGVPLGVCLDGEQQKASGLLRCLEQRVLGQRYAMSAI
ASQVLICRADLKDPVKPDGVFLLAGPSGTGKTETARALAEFVYGDENKLITINMTEFQEAHTVSTLKGAP
PGYVGFGQGGTLTERVSHNPYSVILLDEIEKAHPDVLEFFFQIFDSGIIEDAEGKMVSFRDCLIIMTSNF
ASENITNIWNDGETNRDRIKEMLLPLFNEHFGAAFMGRTNLIPFTPLHSKTLRDIVLIKIDKICQRFEQA
SGQMYKIEYNDSLIDWITHHCQCDKSGARDIDSVLNSTVLPVLARYLTDSEDNRTPKKIRISVRKNNITL
RSSQFATRN
 
Nucleotide Sequence: 2550 bp     [Download]
>gi|410480139|ref|NC_018650.1|:908119-910668 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
GTGAGTATCTATCTGAAACCAATTATTAATAAATTAGCTCCAGAAAGTCGAAATACTCTGGATTCTGCAA
TTAATTACGCAATATCAAGGTCACATCATGAAGTAGACTGTCTACATCTTCTATGGAAGTTATTGCAGGA
ACATAAATATATAGCCGAAGTGCTTTATGAGCAGTCCTTATTTAATCCTGAGAGGGTTCTTAATGCTATT
GAAAGTGAACTTATCCGTATCAATACAGTACCACAATCCTCACCTGTATTTTCTGAGTCGATGCAGACTC
TACTGGAGAAAACATGGATACATGCCAGTACTAAATGGCAAATCGATCATATAGATATCCCTGTCTTTTT
GAGTACTATGATTAATTTAAGAGATTCAATATTTCCTCTCAATGTTTCTGATGCGTTATGTTGTGATATG
GATGTAGCTGAGGAGTTACTTATCTCTTTTTCAGACGAAGCAGAGCATTCTGCTTCTCATCGTCCCACCG
ATAGGTCTTCACATGAATATCTCAGTAAATATACTGAGAATCTCTCTCTGCGGGCAGAAACAGGTAAATT
AGATCCGGTTACTGGCAGAGAGAAGGAAGTCAGACAACTTATCGATATTTTGCTTCGTCGCAGACAGAAT
AATCCAATACTGACCGGTGAACCGGGAGTAGGGAAAAGTAGTATAGTAGAAGGTTTAGCACTGCAAATTG
CGTCTGGCCGTGTGCCTGATGTACTGAAGAATGTCCGGATCCATGCCCTTGATATGGGGGCTCTGCTTGC
GGGAGCCAGTGTCAGAGGGGAATTCGAAAATCGCCTAAAATCACTGTTGACCGAACTTAATTCTTTGGAT
GGCACAGCTATTTTGTTTATTGATGAGGCTCATTCCCTTATCGGTGCAGGAGGACTTCCGGGACAGACTG
ATGCAGCTAATTTGCTTAAGCCTGCTCTTGCCCGTGGAGAATTGCGCATTATAGCCGCAACGACATGGGG
AGAATATAAAAAGTATTTTGAAAAGGATGGGGCGTTAGCCCGGCGTTTTCAGATAGTAAAAGTAGCAGAG
CCAAATCAGGATGTCACAGCGGAAATGCTACGTTCTCTTTTGCCCATGATGGAAAAACACCATAATGTTT
CTATCAGGGAAGAAGCAATAACTGCAACGGTACATCTATCAGACCGTTATCTGCATGGGCGCCGTCAACC
AGATAAATCTGTAAGTCTGTTAGATACAGCTTGTTCTCGGGTTGCTGTATCTCAGTCTACATCACCAGAT
GCCATTCAGGATGTCGAAGCTTCATTGGTAAGATACCAAGGGGAACTTGCGCTGCTGACACAGGAAAGGT
CAGATGTTTTGCGTCAGGAAATGCTTGCAAATAAAATTGCTCAACTTGAGGAGGAGCTTGAGCAACTCAA
ATCAGCGTGGCGTCATCAAAGTGAACTGGTTGCAAGAATACAAAGTTCAGATGATATTTCATCAAAGAAT
ATGTACAGAAAAGAACTGGAAAGTGCATATAAGAAAGACAGTCCTATGGTTTTTGAGTGTGTGGATAAAA
ATTGTGTTGCTGATGTTGTTTCTGGGTGGACAGGTGTTCCACTGGGTGTATGCCTTGATGGTGAACAACA
AAAAGCATCCGGTCTGTTAAGATGCTTGGAGCAGCGAGTTTTGGGGCAGCGATATGCTATGTCCGCTATT
GCATCACAAGTTCTTATTTGTCGGGCAGATCTTAAAGATCCTGTAAAACCTGATGGGGTATTTTTACTTG
CGGGCCCTTCTGGCACAGGCAAAACGGAGACAGCCAGGGCGCTGGCCGAGTTTGTTTATGGGGATGAGAA
TAAACTCATCACGATTAATATGACTGAATTTCAGGAAGCTCACACTGTTTCCACTCTGAAGGGGGCACCT
CCTGGATATGTTGGTTTTGGTCAGGGAGGGACTCTTACTGAAAGGGTGAGTCATAATCCATACAGTGTTA
TTCTGCTTGATGAAATTGAAAAAGCACATCCGGATGTCCTGGAGTTCTTCTTCCAGATATTTGACTCAGG
TATTATCGAGGATGCTGAAGGTAAGATGGTGTCTTTCAGAGATTGTCTCATAATAATGACATCAAACTTT
GCCAGTGAAAATATCACAAACATATGGAATGATGGTGAGACAAATAGAGACAGAATAAAAGAAATGCTTC
TTCCTTTGTTTAATGAGCATTTTGGGGCGGCATTTATGGGGAGAACTAACTTAATTCCGTTCACACCGTT
GCATTCCAAAACACTGAGAGATATCGTACTCATTAAAATTGATAAGATCTGCCAACGTTTTGAACAGGCA
TCAGGTCAGATGTATAAGATAGAATACAATGATTCTCTTATTGACTGGATTACACATCATTGTCAATGTG
ATAAGTCTGGAGCTAGGGATATAGACTCAGTACTTAACAGCACGGTTCTTCCTGTCTTGGCCAGATATTT
GACTGACTCTGAAGATAATAGAACCCCCAAGAAAATAAGAATATCAGTAAGGAAAAATAACATTACATTA
CGTAGTTCGCAATTTGCAACTCGTAATTGA
 Primer design