SecReT6
Protein ID: 410484118
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20205
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4146167..4146952 [-]
Producthypothetical protein
NoteTagL
UniProt IDJ9ZQP2, J9ZQP2
KEGG IDesm:O3M_20205
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.10E-15, Aligned region: 71..87
OmpA [PF00691], Evalue: 5.10E-15, Aligned region: 120..213
Protein Sequence: 261 a.a.     [Download]
>gi|410484118|ref|YP_006771664.1| hypothetical protein O3M_20205 [Escherichia coli O104:H4 str. 2009EL-2050]
MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHPPKPATVAVPEETEKKARDVNEKTVL
LKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNMFERGSAQIMPFFKRLLVELA
PVFDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNP
QSAGNRRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR
 
Nucleotide Sequence: 786 bp     [Download]
>gi|410480139|ref|NC_018650.1|:c4146952-4146167 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
GTGACGACGATAAAGTTGATTGTCAACAGCGTCAGTAAATCCGAGCGTGAAAGCATTATCGCCGCGCTGC
ACGGGCAGTCGATTTTTAACGGTGGTGGGCTGTCGCCGTTAAATAAAATCAGCCCGTCTCATCCGCCAAA
ACCTGCCACCGTGGCGGTGCCGGAAGAGACGGAGAAAAAAGCGCGTGACGTCAATGAGAAAACGGTGCTG
CTGAAGAAGAAATCCGCCACCGAGCTTGGCGAGCTGGCAACCAGTATCAACACCATTGCCCGTGATGCGC
ATATGGAAGCGAATCTGGAGATGGAGATTGTCCCGCAGGGATTACGCGTGCTGATTAAAGACGACCAGAA
TCGCAATATGTTCGAACGCGGCAGCGCGCAGATTATGCCGTTCTTTAAAAGGCTGCTGGTGGAGCTCGCG
CCAGTTTTCGACTCGCTCGATAACAAAATTATTATTACCGGGCATACCGATGCGATGGCCTACAAAAACA
ATATCTACAACAACTGGAACCTTTCGGGCGATCGCGCGCTTTCAGCTCGTCGGGTGCTGGAAGAGGCCGG
AATGCCGGAAGATAAAGTGATGCAGGTAAGCGCAATGGCGGACCAGATGCTGCTGGACGCGAAAAATCCG
CAAAGCGCGGGCAACCGGCGCATTGAGATTATGGTGCTGACCAAAAGTGCGTCCGATACGCTGTATCAAT
ACTTTGGTCAGCATGGGGATAAAGTGGTGCAGCCGCTGGTGCAAAAGCTGGATAAGCAGCAGGTGCTTTC
ACAGCGAACGCGCTAG
 Primer design