SecReT6
Protein ID: 410484134
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20295
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4161680..4164184 [-]
ProductRhs core protein
NotePAAR
UniProt IDJ9ZQF0
KEGG IDesm:O3M_20295
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 213..247
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 329..365
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 356..388
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 438..476
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 462..496
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 502..525
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 548..581
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 588..624
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 630..665
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 671..701
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 705..722
RHS_repeat [PF05593], Evalue: 1.40E-57, Aligned region: 733..772
Protein Sequence: 834 a.a.     [Download]
>gi|410484134|ref|YP_006771680.1| Rhs core protein [Escherichia coli O104:H4 str. 2009EL-2050]
MGGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPTKKDSPNYGSPVNPLLGAKVLPVETDLAL
PGPLPFILFRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDSGGRSIHFEPLFPGEISYSRS
ESFWLARGGVLKQHKGHPLARLWRALPEAVRLSPHTYMMAVSTTGQWLILGWPERVPEADEVPPPEPPAY
RVLTGVVDGFGRSLIFHREAAGELAGEITGVTDGAGRRFHLALSTQAQRAEAFRKQRVTSLSSPAGPRSV
SSSQVFPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTASGELRAVYDRSGTQVRGFT
YDAEHAGRMVAHHYAGRPESRYRYDDTGRVTEQVNPEGLDYRFEYGESRVIITDSLNRREVLYTEGEGGL
KRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYRLHMASGKLTSVILPDGRTVRYGYNSQLQLTSV
TYPDGLRSSRKYDRQGRLAEEISRNGNITRWFYDSSRSGLPCAVEDGTGVRRRITRNRYGQLQAFTDCSG
YATRYEYDRYGQQIAIHREEGISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTATISPDGKRSTIEY
DKRGRPVSVTEGGLTRSMGYDAAGRITTLTNENGSQSTFLYDPVDRLTEQRGFDGRTQRYQYDLTGKLTQ
SEDEGLITLWHYDASDRITRRTVNGEPAEQWQYDDHGWLTEISHLSEGHRVAVHYGYDDKGRLTGERQTD
GEDGPHPDGCDTDGRRADPPLPLRQPAPPGVPHADTAWRATGREPLPLRPAGTANGETGMAAGA
 
Nucleotide Sequence: 2505 bp     [Download]
>gi|410480139|ref|NC_018650.1|:c4164184-4161680 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGGGCGGCGGAAAACCGGCGGCGCGGCAGGGTGACATGACCCGCAAGGGACTGGATATTGTGCAGGGTT
CAGCAGGGGTGCTGATAGGTGCGCCAACCGGTGTGGCCTGCTCGGTGTGTCCCACAAAAAAGGACAGTCC
GAACTATGGCAGCCCGGTGAACCCGCTACTCGGTGCGAAGGTTCTGCCTGTTGAAACCGACCTGGCACTG
CCCGGCCCGCTGCCGTTTATTCTTTTCCGCGCCTACAGCAGCTACCGGACCAGGACGCCCGCGCCAGTGG
GCGTGTTTGGTCCCGGCTGGAAAGCGCCCTTCGATATCCGCTTACAGATACGCGATGAAGGCCTGATACT
CAACGACAGCGGTGGTAGGAGCATTCACTTTGAGCCGTTGTTTCCCGGCGAGATAAGCTACAGCCGCAGC
GAGTCGTTCTGGCTGGCAAGGGGCGGAGTGCTGAAACAACACAAAGGCCATCCGCTTGCGCGGCTCTGGC
GGGCGTTGCCGGAAGCGGTCCGTCTGAGTCCACACACCTATATGATGGCTGTCAGCACAACCGGGCAGTG
GCTGATACTCGGCTGGCCGGAGCGTGTGCCGGAGGCGGACGAGGTGCCGCCGCCGGAGCCGCCCGCATAC
CGGGTGCTGACGGGCGTGGTGGACGGCTTCGGGCGCTCACTGATTTTCCACCGCGAGGCCGCAGGCGAGC
TGGCTGGCGAAATCACCGGGGTGACGGACGGCGCGGGCCGCCGTTTTCACCTGGCACTGAGCACACAGGC
GCAGCGGGCGGAAGCCTTCCGTAAACAGCGCGTCACGTCTTTATCCTCCCCTGCCGGTCCCCGTTCTGTT
TCCTCTTCTCAGGTTTTCCCCGACACGCTGCCCGCCGGTACAGAGTACGGTGCCGATAACGGTATCCGGC
TGGAGGCGGTGTGGCTGACACACGACCCGGCCTACCCGGATGAACAGCCGACTGCGCCGCTGGCGCGCTA
CACGTACACGGCCAGCGGAGAACTGCGGGCGGTGTATGACCGCAGCGGGACGCAGGTTCGCGGGTTTACT
TATGATGCGGAGCACGCCGGGCGGATGGTGGCACACCATTATGCGGGGAGGCCGGAGAGCCGCTACCGGT
ATGATGATACCGGTCGGGTGACGGAGCAGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGAGA
GAGCCGGGTAATCATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAAGGCGAGGGTGGCCTG
AAGCGGGTGGTGAAGAAGGAGCATGCCGACGGGAGCATCACCCGCAGCGAGTATGATGAGGCGGGGAGGC
TGAAGGCGCAGACGGATGCGGCGGGGCGGCGGACGGAGTACCGGCTGCATATGGCGTCTGGAAAGCTGAC
TTCAGTGATACTGCCGGACGGCAGGACGGTGCGGTATGGCTATAACAGCCAGTTGCAACTGACTTCAGTG
ACATATCCGGATGGTTTACGCAGCAGCCGGAAATATGACCGTCAGGGCCGACTGGCAGAAGAGATCTCGC
GCAACGGTAACATTACGCGCTGGTTTTATGATTCTTCCCGCAGTGGCCTGCCCTGTGCGGTGGAAGACGG
AACCGGGGTGAGGCGGAGAATAACGCGAAACCGGTACGGTCAGCTTCAGGCCTTTACGGACTGCTCGGGG
TACGCGACGCGGTATGAATATGACCGGTACGGTCAACAAATCGCCATTCACCGGGAAGAAGGCATCAGCA
CTTACAGCAGTTATAATCCGCGTGGCCAACTGGTCAGTCAGAAGGATGCGCAGGGGCGTGAAACCCGTTA
TGAGTACAGCGCCGCAGGCGACCTGACAGCGACGATATCACCGGACGGTAAACGCAGCACCATCGAATAT
GATAAACGCGGGCGTCCGGTGAGTGTGACGGAAGGCGGACTGACGCGCAGCATGGGGTATGACGCCGCCG
GGCGCATCACCACGCTGACTAATGAGAACGGCAGCCAGTCCACGTTCCTGTATGACCCGGTGGACAGGCT
GACGGAGCAGCGCGGCTTTGATGGCAGGACGCAACGTTACCAGTATGACCTGACCGGAAAACTCACGCAG
AGTGAAGATGAGGGGCTTATCACCCTCTGGCATTACGATGCGTCGGACCGTATCACCCGGCGCACGGTGA
ACGGTGAACCGGCGGAGCAGTGGCAGTATGACGACCACGGCTGGCTGACAGAAATCAGCCACCTGAGTGA
AGGCCACCGTGTGGCGGTCCACTACGGCTATGACGATAAAGGCCGTCTGACGGGCGAACGGCAGACTGAC
GGAGAAGACGGACCGCATCCCGACGGGTGTGATACGGACGGACGACGAGCGGACCCACCACTACCACTAC
GACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCATGGCGAGCCACTGGTCGAGAGCCGCTACC
TCTACGACCCGCTGGGACGGCGAATGGCGAAACGGGTATGGCGGCGGGAGCGTGA
 Primer design