SecReT6
Protein ID: 410484138
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20315
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4167826..4168326 [+]
Producthypothetical protein
NoteTssB
UniProt IDJ9ZQR4
KEGG IDesm:O3M_20315
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-55, Aligned region: 7..161
Protein Sequence: 166 a.a.     [Download]
>gi|410484138|ref|YP_006771684.1| hypothetical protein O3M_20315 [Escherichia coli O104:H4 str. 2009EL-2050]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSPLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGLVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|410480139|ref|NC_018650.1|:4167826-4168326 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAGCGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCCCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACTGTCCCCGCCACGCTGAAGGGAAGCACAACAGACGATGAACTGAATG
TGGCGCTGAATATCAAATCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGTCTGGTGA
GCAATAAATAA
 Primer design