SecReT6
Protein ID: 410484139
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20320
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4168361..4168585 [+]
Producthypothetical protein
NoteTssC
UniProt IDJ9ZQG0
KEGG IDesm:O3M_20320
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|410484139|ref|YP_006771685.1| hypothetical protein O3M_20320 [Escherichia coli O104:H4 str. 2009EL-2050]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|410480139|ref|NC_018650.1|:4168361-4168585 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA
 Primer design