SecReT6
Protein ID: 410484140
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20325
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4168636..4170111 [+]
Producthypothetical protein
NoteTssC
UniProt IDJ9ZRQ5
KEGG IDesm:O3M_20325
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-188, Aligned region: 68..489
Protein Sequence: 491 a.a.     [Download]
>gi|410484140|ref|YP_006771686.1| hypothetical protein O3M_20325 [Escherichia coli O104:H4 str. 2009EL-2050]
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASAEPVNKLAVDS
MIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNT
AWMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITL
TMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLDR
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|410480139|ref|NC_018650.1|:4168636-4170111 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGTCTTTACAGGAAGAGGAACTCGTATCCAGTCATGCCGGGCAGCCTGAGCAGGCATCGTCGCTGCTTG
ATCAAATCATGGCACAGACCCGTATTCAGCCCGGTTCGGAAGGTTATGACGTTGCCCGCCAGGGTGTGAC
AGCCTTTATTGCCAGCATCCTGCAATCCACTGCATCTGCCGAACCGGTCAATAAACTGGCCGTGGACAGC
ATGATTGCAGATATTGATGAACGCATCAGCCGCCAGATGGATGTCATCATCCATGCGCCTGCCTTTCAGC
AGGTCGAGTCGTTCTGGCGCTCACTGAAAACCATGGTGGATCGCGTTGATTTCCGTGAAAACATCAAGGT
CAACGTGCTTCATGTCACCAAGCAGGAACTTCTGGAAGACTTTGAGTTTGCGCCAGAAATTATTCAGTCC
GGATTTTATAAGCACGTTTATTCGTCCGGTTTCGGACAGTTTGGCGGTGAACCCATCGCTGCCGTGCTGG
GCGCTTATGAGTTCAAAAATACCGCGCCTGACATGAAACTGCTGCAATACGTCAGTGCCGTGGGCGCAAT
GGCGCACGCACCGTTCCTGTCCTCCGTTTCCCCGGAGTTTATGGGGCTGAACTCGTGGACCGAACTGCCT
AATATCAAAGATCTTTATGCCATCTTTGAAGGTCCGGCCTACACCAAATGGCGCGCCCTGCGTGACTCGG
AAGATTCGCGCTATTTAGGGCTTACGGCACCCCGCTTCCTGCTTCGCCAGCCCTATTCACCAACAGATAA
CCCTGTTAAGAACTTTAACTATTACGAAGATGTCAGCCAGAACCACGAAGATTATCTGTGGGGTAATACG
GCCTGGATGCTGGCATGCAATATCGCAGACAGTTTTGCCAAATACCGCTGGTGTCCAAACATTATCGGTC
CGCAAAGCGGCGGCGCAGTGAAAGATCTGCCGGTGCATCTGTTCGAAACGATGGGGCAGATTCAGGCCAA
AATCCCAACCGAGGTGCTGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTT
ACCATGCGTAAAGACTCTGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTC
CGGGAAAAGATGCAGAAACCAACTATAAGCTGGGTACGCAGCTTCCTTATCTCTTCATCATCAATCGGTT
AGCGCACTACATCAAGGTGTTGCAGCGTGAACAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAAAGA
GAGCTTAATACCTGGATCCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCAGACGTGCGCAGCCGCA
AACCTCTGCGCGCTGCCAAAGTTGAGGTTATGGATGTAGAAGGCGAACCCGGCTGGTACCAGGTTGCGCT
AAGCGTGAGACCTCATTTTAAATTTATGGGGGCAAATTTTGAGCTTTCCCTGGTTGGCCGGTTAGACAGG
GAGTAA
 Primer design

Protein ID: 410484139
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20320
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4168361..4168585 [+]
Producthypothetical protein
NoteTssC
UniProt IDJ9ZQG0
KEGG IDesm:O3M_20320
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|410484139|ref|YP_006771685.1| hypothetical protein O3M_20320 [Escherichia coli O104:H4 str. 2009EL-2050]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|410480139|ref|NC_018650.1|:4168361-4168585 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA
 Primer design