SecReT6
Protein ID: 410484141
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20330
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4170118..4170531 [+]
Producthypothetical protein
NoteTssE
UniProt IDJ9ZSN4
KEGG IDesm:O3M_20330
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 31..118
Protein Sequence: 137 a.a.     [Download]
>gi|410484141|ref|YP_006771687.1| hypothetical protein O3M_20330 [Escherichia coli O104:H4 str. 2009EL-2050]
MIPDRERTTGSLFERMEASSARNRQGGSIYSLRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
SMSRAIEQCIERYEPRISHAEVQAVVSSASSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>gi|410480139|ref|NC_018650.1|:4170118-4170531 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGATACCGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCTTCGGCCAGAAACC
GGCAGGGAGGCAGTATTTATTCGCTCAGGCAATCCATTCGCCAGAACCTACGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAGCTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TCCATGAGTCGGGCCATCGAGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CAGTGGTTTCATCCGCCTCCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACGCATGAGGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTACCGGGTGGACTGA
 Primer design