SecReT6
Protein ID: 410484147
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20360
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4176596..4177357 [+]
Productmembrane protein Aec26
NoteTssL
UniProt IDJ9ZRE6
KEGG IDesm:O3M_20360
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.20E-60, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|410484147|ref|YP_006771693.1| membrane protein Aec26 [Escherichia coli O104:H4 str. 2009EL-2050]
MDEGSLSLPPFTGYDEKSQRNYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWICFSLGFRGRYKVAAQDQGEFEQIYRRLYHVQHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTVKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|410480139|ref|NC_018650.1|:4176596-4177357 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCAGCGCAACTACCATC
TCGCGCTTCGTGGCAACAGCCTGAATCCGATGATCGACGCGGCCACGCCGCTACTCGGTATGGTAATGCG
CCTTTCAACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACGGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAGCAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCAAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGAGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGATCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGCACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGTCTGTACCACGTTCAGCATAAACT
GCGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACTGTTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA
 Primer design