SecReT6
Protein ID: 410484148
SecReT6 ID700
T6SS typei1
Gene symbol-
Locus tagO3M_20365
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]4177366..4180125 [+]
ProductATP-dependent Clp proteinase ATP-binding subunit
NoteTssH
UniProt IDJ9ZQS8
KEGG IDesm:O3M_20365
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-38, Aligned region: 261..261
AAA_2 [PF07724], Evalue: 1.30E-38, Aligned region: 642..803
AAA [PF00004], Evalue: 1.10E-16, Aligned region: 223..334
AAA [PF00004], Evalue: 1.10E-16, Aligned region: 648..765
AAA_5 [PF07728], Evalue: 7.30E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 7.30E-14, Aligned region: 647..767
ClpB_D2-small [PF10431], Evalue: 2.70E-12, Aligned region: 809..885
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 618..688
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 713..741
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 838..885
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 446..483
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 646..681
AAA_25 [PF13481], Evalue: 3.80E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.80E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 3.80E-05, Aligned region: 642..676
AAA_25 [PF13481], Evalue: 3.80E-05, Aligned region: 775..839
AAA_29 [PF13555], Evalue: 8.20E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 8.20E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 8.20E-05, Aligned region: 645..672
AAA_14 [PF13173], Evalue: 8.80E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 8.80E-05, Aligned region: 647..737
NACHT [PF05729], Evalue: 0.0001, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.0001, Aligned region: 283..345
NACHT [PF05729], Evalue: 0.0001, Aligned region: 453..453
NACHT [PF05729], Evalue: 0.0001, Aligned region: 648..676
AAA_19 [PF13245], Evalue: 0.00022, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00022, Aligned region: 641..669
DUF258 [PF03193], Evalue: 0.00031, Aligned region: 198..239
DUF258 [PF03193], Evalue: 0.00031, Aligned region: 648..666
AAA_17 [PF13207], Evalue: 0.0031, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0031, Aligned region: 648..682
AAA_18 [PF13238], Evalue: 0.0057, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0057, Aligned region: 648..683
IstB_IS21 [PF01695], Evalue: 0.0094, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0094, Aligned region: 647..658
Protein Sequence: 919 a.a.     [Download]
>gi|410484148|ref|YP_006771694.1| ATP-dependent Clp proteinase ATP-binding subunit [Escherichia coli O104:H4 str. 2009EL-2050]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTMTDASDTLLARYAKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESEQDNTGAKLADEAGSEQPEETAETVSPVQRLAQLT
AELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPVWLGDTIKGQDLAIASLHKHL
LTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYV
GYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQV
IVEHADDPETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLTTIIDGKLARLDNVLRSRFDADVIIE
SEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAADGAFTADVEDALDDE
SVTEDETDL
 
Nucleotide Sequence: 2760 bp     [Download]
>gi|410480139|ref|NC_018650.1|:4177366-4180125 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCTGAATGTATGAGTCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTCATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
CTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTTAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACAATGACGGACGCCTCTGACACCCTGCTTGCCCGCTATGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCAC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACTTGGGCGCATTGCAGGCCGGGGCGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCGGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGA
GCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATTGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAACAGGATAATACCGGTGCTAAACTGGCTGATGA
AGCTGGCAGCGAACAGCCGGAAGAGACCGCAGAAACAGTTTCCCCGGTGCAGCGACTGGCACAGCTCACT
GCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTCTCCCCGCACGTCGATAAAAAACAGATTGCGG
CGGTGATTGCCGAATGGACCGGCGTACCGCTTAACCGCCTGTCACAGAATGAGATGTCGGTCATCACCGA
CCTGCCGGTATGGCTGGGTGACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCATAAACACCTG
CTGACTGCACGCGCCGACCTGCGTCGTCCGGGACGCCCACTCGGCGCGTTTCTGCTGGCCGGTCCCAGCG
GCGTGGGTAAAACCGAAACCGTCCTGCAACTGGCAGAACTGCTCTACGGCGGTCGCCAGTACCTGACCAC
CATCAATATGTCCGAGTTCCAGGAAAAACACACCGTCTCGCGGCTGATTGGCTCCCCTCCGGGCTATGTC
GGCTATGGCGAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAAACCGTACTCGGTGGTGCTGCTTGATG
AAGTGGAAAAAGCGCACCCGGATGTCCTCAACCTGTTCTACCAGGCGTTCGACAAGGGCGAGATGGCAGA
CGGCGAAGGCCGACTGATTGACTGTAAGAATATCGTTTTCTTCCTCACCTCCAACCTTGGTTACCAGGTG
ATTGTTGAACACGCGGATGACCCGGAAACCATGCAGGAAGTGCTGTATCCGGTGCTGGCGGACTTCTTTA
AACCAGCCCTGCTGGCGCGTATGGAAGTGGTGCCGTACCTGCCTCTGTCGAAAGAGACGCTCACCACCAT
TATCGACGGGAAACTGGCCCGCCTGGATAACGTGCTGCGCAGCCGCTTTGATGCGGACGTGATTATTGAG
TCGGAAGTGACGGACGAGATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCAAGGATGCTGGAGTCCG
TCATTGACGGCGACATGCTGCCCCCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGCCAACACGGCGAT
TGCCCGCATCCGCCTGTCGGCGGCAGACGGCGCGTTCACGGCAGACGTGGAAGATGCTCTGGACGACGAG
TCTGTCACAGAGGATGAAACGGATTTATGA
 Primer design