SecReT6
Protein ID: 410663450
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04420
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]973379..976915 [+]
Producthypothetical protein
NoteTssM
UniProt IDK4KGH7
KEGG IDsaga:M5M_04420
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.60E-95, Aligned region: 92..112
ImcF-related_N [PF14331], Evalue: 2.60E-95, Aligned region: 196..458
ImcF-related_N [PF14331], Evalue: 2.60E-95, Aligned region: 728..760
IcmF-related [PF06761], Evalue: 1.50E-48, Aligned region: 509..807
DUF1215 [PF06744], Evalue: 4.90E-27, Aligned region: 919..1040
AAA_19 [PF13245], Evalue: 0.0013, Aligned region: 131..148
AAA_19 [PF13245], Evalue: 0.0013, Aligned region: 610..652
AAA_19 [PF13245], Evalue: 0.0013, Aligned region: 820..861
Protein Sequence: 1178 a.a.     [Download]
>gi|410663450|ref|YP_006915821.1| hypothetical protein M5M_04420 [Simiduia agarivorans SA1 = DSM 21679]
MKRLADFFTHKWTLGILGLLALSCVVWFGADYIKFGEDNHTLSSTTRIAIIGVCWLIWIVWQIATLVLER
RQNDALIASIQEEPESVSPDEERSREELETIAQRFREAMVTLKKARFKKGGRALSLYQLPWYIIIGPPGA
GKTTALINSGLEFPLAKQSDQKPLAGVGGTRNCDWWFTNDAVLIDTAGRYTTQDSHRAIDNTAWRAFIDL
LKRHRRRRPINGAILAISLQDLMVQTAEQRTHQAKTLRTRINELHQEFGIRFPIYLTFTKCDLVAGFAEF
FSNLSQAEREQVWGVSFPYSTDADVDQAIAGFSGEFDLLIERLNQRVLWRVQQERNLDRRAVLQAFPARM
EALSEVISEFVKQTFAGNRYDTQPLLRGVYFTSATQEGSPIDRMMASVSANFGLDRDMGKVQNNSGKSFF
LHRLLKHIIFPESELVGVNKKIETSLLWGRRAAMAALTLATAGTLLLWSGSLAQNKIKMAEVSQATDAFQ
TLEPALRQATPDLETVAKAFEHLAHASSVYDQDDHPWLQNLGLYDPSVDHAADRLYSAKLREYFYPLLAK
TLAAKVREDQYKDAELIDSLKLYLMLFDSERRDLAAIGEKTNKLWTEQLTGKATVLKALNTHLLKALQEP
VPQDFVSDTRLVQQSRRQLARMPVAQRIFGRLESGNLGQTEVSITEALGLGSPEDLGLDSNSESARIPLL
YTKASYKELDFTAESPLLDQLDQDRWIYGGNLASQDLTETDREQIIGQVKKRYMTRYADEWNKLLAAVQL
TRLNSTHQAIDLLDQWADPISSPLLALIQITAENTELTPSLDLDINTGAAARIAGGRAATVASLGGQALG
SLASRLPPTPVDLQFDEIHRLVKTADNRPAKIQDYLAALDELKEFLMEIDSAPDSNEAAFVAAKARFGNG
GGGQIKQLRVKAQGAPEPLNLWINAIADQTWGLLLAKTKLHIDQIWHEQVFSSYRSNLQGRYPMASHVEF
ETPVGEFNRYFKPGGIEQQFVNSYLSHFIDVRRWTVKSLEGQSLKISNKSLRQFRQADDIRRAYFSGGPN
ASMQFKIEPTKLDSGVRLFALELGENRVNYSHGPRTLKPMKWTGGEDMRVRVIFEDLNETVHRKHYEGDW
SWLRLLDDSHIDETGNKSIKHIVFEENGRRAEFRLVANTGVNPFDRQLLKNYDCPQYL
 
Nucleotide Sequence: 3537 bp     [Download]
>gi|409101470|ref|NC_018868.1|:973379-976915 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGAAACGCCTGGCGGACTTTTTTACCCATAAATGGACTTTGGGGATACTGGGATTGCTCGCGCTGTCCT
GCGTTGTTTGGTTTGGTGCTGACTACATCAAATTCGGAGAGGACAACCACACATTAAGCAGTACGACGCG
AATCGCGATTATCGGGGTCTGCTGGCTGATATGGATTGTCTGGCAAATAGCCACTCTGGTACTCGAGCGT
CGTCAGAATGACGCACTCATAGCGTCTATTCAGGAAGAGCCGGAGAGCGTATCCCCCGATGAAGAGCGCA
GCCGCGAAGAGTTAGAGACCATTGCCCAGCGGTTCCGCGAAGCAATGGTGACCCTCAAAAAAGCACGCTT
CAAAAAGGGAGGCCGGGCCCTTAGCCTTTATCAACTTCCCTGGTATATCATCATCGGCCCGCCGGGTGCC
GGCAAAACCACAGCCCTGATAAATTCCGGCCTGGAATTCCCACTCGCCAAACAATCCGATCAAAAACCCC
TGGCAGGCGTTGGCGGCACCCGTAACTGCGATTGGTGGTTTACCAACGATGCCGTGCTGATCGATACGGC
CGGCCGATACACAACCCAGGACAGCCATCGCGCCATCGACAACACTGCATGGCGAGCGTTTATAGACCTG
CTTAAAAGACATCGTCGCCGGCGGCCGATTAATGGCGCAATCCTCGCGATCAGCCTGCAAGACCTGATGG
TCCAGACTGCTGAGCAACGCACTCACCAAGCTAAAACGCTGCGCACACGTATTAACGAGCTGCATCAGGA
GTTTGGTATCCGGTTCCCCATTTATCTTACCTTTACCAAATGTGATTTAGTCGCTGGATTCGCCGAGTTT
TTTTCCAACCTATCGCAGGCCGAGCGAGAGCAGGTATGGGGCGTAAGTTTCCCCTACTCCACAGACGCAG
ATGTTGATCAAGCCATCGCCGGGTTCAGCGGAGAATTTGATCTGTTGATTGAACGCCTAAACCAACGGGT
ACTGTGGCGGGTTCAGCAGGAGCGAAATCTGGACCGCAGAGCAGTACTGCAGGCATTTCCTGCACGCATG
GAGGCGTTATCGGAAGTTATCAGCGAATTTGTGAAGCAGACTTTTGCGGGCAATCGTTATGACACACAAC
CGCTACTGCGTGGTGTTTACTTCACCAGTGCAACACAGGAAGGCTCCCCTATTGATCGGATGATGGCCAG
CGTCTCCGCCAATTTTGGCCTTGATCGTGACATGGGCAAGGTCCAAAACAATTCCGGCAAAAGCTTTTTC
CTGCACCGACTCCTTAAGCACATCATATTCCCAGAATCGGAACTGGTTGGCGTAAACAAGAAAATCGAAA
CCTCGCTCTTGTGGGGCAGAAGAGCCGCCATGGCAGCATTAACGCTGGCGACCGCCGGCACATTGCTACT
GTGGTCCGGAAGCCTCGCTCAGAATAAAATCAAGATGGCCGAAGTCAGCCAGGCCACCGACGCGTTTCAG
ACATTGGAACCCGCCCTTCGCCAAGCTACCCCTGACCTGGAAACCGTCGCCAAAGCATTTGAACATCTCG
CACATGCATCCAGTGTTTATGACCAGGACGATCATCCCTGGCTGCAAAATCTTGGGCTTTACGATCCCAG
TGTAGATCACGCTGCCGACCGCCTCTACAGCGCCAAACTGAGAGAGTATTTCTATCCGTTACTGGCCAAA
ACCCTTGCTGCAAAGGTTCGCGAAGATCAGTATAAAGACGCCGAACTTATCGACAGTCTGAAGCTCTATC
TTATGTTATTCGACAGCGAACGACGGGATTTGGCTGCGATCGGTGAAAAAACCAACAAACTCTGGACCGA
ACAACTTACCGGCAAAGCAACGGTACTTAAGGCGTTGAATACGCATTTATTGAAAGCGCTTCAGGAGCCA
GTGCCACAGGACTTCGTATCGGACACACGACTGGTACAACAGAGCCGACGCCAATTGGCTCGGATGCCGG
TGGCGCAGCGTATCTTCGGCCGCCTCGAATCTGGCAACCTTGGCCAGACGGAGGTTTCCATTACAGAAGC
CCTCGGCCTTGGCTCACCAGAGGACCTGGGACTTGATAGCAACAGCGAAAGCGCTCGCATCCCCCTGCTC
TACACTAAAGCGAGCTACAAAGAGCTGGACTTCACGGCCGAATCCCCTCTCCTGGACCAGTTGGATCAGG
ACCGCTGGATCTACGGTGGGAATCTCGCAAGCCAGGATCTGACCGAAACCGATAGAGAGCAGATCATTGG
TCAGGTCAAAAAACGTTACATGACTCGCTATGCAGACGAATGGAACAAGCTACTGGCGGCGGTACAATTA
ACTCGCCTTAATTCAACTCACCAGGCAATTGACTTGCTCGACCAGTGGGCCGATCCGATATCCTCGCCCT
TACTCGCGCTGATCCAAATTACTGCCGAGAATACTGAGCTTACACCAAGTCTGGATTTGGACATCAACAC
GGGTGCGGCAGCAAGAATAGCGGGTGGGCGGGCTGCCACCGTGGCTAGCCTGGGTGGTCAGGCACTGGGC
TCCTTAGCATCCAGACTTCCGCCTACGCCGGTTGATCTGCAATTCGACGAGATACACCGCCTAGTAAAGA
CCGCTGATAATCGACCCGCGAAAATTCAGGATTACCTCGCAGCGCTGGATGAATTGAAAGAGTTTCTGAT
GGAAATTGACAGTGCTCCTGACTCCAACGAAGCCGCGTTCGTGGCAGCGAAAGCGCGGTTTGGCAACGGT
GGCGGCGGCCAAATCAAGCAACTCAGGGTAAAAGCGCAAGGCGCTCCAGAGCCACTGAACCTATGGATAA
ACGCCATTGCCGATCAGACATGGGGCCTTCTACTTGCGAAAACGAAATTGCATATAGATCAGATTTGGCA
CGAGCAAGTATTCAGCAGCTATCGCAGTAATTTACAGGGGCGCTACCCCATGGCTTCTCATGTAGAATTT
GAAACACCCGTCGGTGAATTCAATCGTTATTTCAAACCTGGCGGGATAGAACAACAATTTGTGAATAGCT
ACCTGTCCCACTTTATCGATGTTCGCCGTTGGACCGTGAAAAGTCTTGAAGGCCAATCACTCAAAATTTC
CAATAAAAGCCTGCGACAATTCAGGCAGGCCGATGATATTCGACGCGCCTATTTTTCTGGCGGCCCGAAC
GCGAGCATGCAATTCAAAATTGAGCCCACAAAGCTTGACTCAGGTGTTCGCTTATTTGCACTTGAGCTAG
GCGAAAACCGGGTGAATTACTCCCATGGCCCACGCACACTCAAGCCCATGAAGTGGACAGGTGGCGAAGA
CATGCGGGTCAGGGTTATCTTTGAAGATCTCAATGAAACGGTGCACCGCAAGCACTACGAAGGCGACTGG
TCGTGGCTTAGATTGCTGGATGACTCACATATCGATGAGACCGGCAACAAAAGCATTAAACATATCGTGT
TTGAGGAAAATGGGCGCCGTGCCGAATTTCGCCTGGTTGCCAACACTGGCGTCAATCCATTCGATCGTCA
ACTTCTGAAAAATTACGACTGCCCACAGTACCTGTGA
 Primer design