SecReT6
Protein ID: 410684639
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10731
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]850569..854480 [-]
Productputative secretion system protein (EvpO-like)
NoteTssM
UniProt IDD8NHK6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.70E-73, Aligned region: 80..102
ImcF-related_N [PF14331], Evalue: 7.70E-73, Aligned region: 183..441
IcmF-related [PF06761], Evalue: 1.40E-52, Aligned region: 488..860
DUF1215 [PF06744], Evalue: 2.70E-27, Aligned region: 996..1109
Protein Sequence: 1303 a.a.     [Download]
>gi|410684639|ref|YP_006060646.1| putative secretion system protein (EvpO-like) [Ralstonia solanacearum CMR15]
MQRFLNFLTHSRTLSILGVIVVTIFLLLIAETFETGLVWAGIALGVLLALWLATVLWKRWRARRASAGLE
GVLEQAADKTAAPDKREEVEALRVRLAEAVKTIKRSKLGQLSGDAALYELPWYIVIGNPAAGKSTAVLNS
GLQFPFADKGGAVIQGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRREWLGFLDLLKRYRPKAPINGIV
VTVSVSELTQNRPEFAINLAKNLRQRVQELTERLEVFAPVYVMFTKADLITGFTEFFGDSEKQERDRVWG
ASLPFEPDAKPDVAALFDQRFDELCDGLKEISVAQISLHQKNKLSPGLLSFPLEFASIKPALRSFLVTLF
DENPFQYKPVFRGFYFTSALQEGATNSASAERIARRFGLSTDGAARSREVFSKNGFFLRDLFSKVIFSDR
QTVRQFASPAKTRLRIATFFGLVLALGLLLGGWTWSYMGNRTLTANVQADLDKIVKLQQNRVDLQARLEA
LDILQDRIEQLERFRGEHPLALSLGLYQGDALQHKLLDEYYNGLRQVMLKPVGGALETFLAEVNTHPEQL
APMVRPPETGAVIATSVTSATATIAASSATASAPASPTATTTAAAGKRFTDASPSNVEDGYNALKTYLML
SDKRHVEVAHLTDQITRFWRGWLEDNRGNMPREQMIRSAERNLSFFLARVNDDNWPLLEGNLSLIDQTRE
NLRRVVRGMPARERAYAEIKARASTRYAPMTVARIVGETGGNVIAGSYAVPGTFTKEAWQGYVQPAIREA
ASKELQTKDWVLNVAARDDLTLEGSPEQIQKTLVTMYKTEYAREWQRFMQGVAVQDFTSFEQAVAGMNLL
GDPTNSPIRKVLDTAYDQTSWDNPSMLNAGLKQAKSGALGWFKQFFSRQTPSQINVNVDVGGNAEAGSIP
MGPVGKEFAGLARVAVMRDDKSLLRGYMDALSKVRTRFNLIKNQGDPGPGARQLMQQTLDGNGSELADTL
KYVDEQMLTGMTDSERQTLRPLLVRPLLQSYAVVIRPASVEINKVWNAQVYQPFSQTLSEKYPFSANAKI
EASAAEIGQIFGPEGAIAKFANTTIGPLSVRRGDMLAARTWGDLGLAFVPEFTSGFTRWIAPLTGGAAGG
AGGAAAAAPQTVFQILPVPSQGTTEYTIEIDGQQLRYRNTPPQWANFVWPNPQGAPGARVTATTFDGRTV
ELLNEPGRFGLERLIATANRKRRPDGAFDLTWARGEISVSVSLRIISSPQTAGTAGSDSPQGQGLRGLRL
PTSIADVAASQNTATPPAPAGSRPASAAAARTLVTQEQGGTAQ
 
Nucleotide Sequence: 3912 bp     [Download]
>gi|410683947|ref|NC_017589.1|:c854480-850569 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGCAACGCTTCCTCAACTTCCTGACCCACTCACGCACGCTATCGATCCTGGGCGTGATCGTGGTGACGA
TCTTCCTGCTGCTGATCGCGGAGACCTTCGAGACTGGCCTGGTCTGGGCCGGCATTGCGCTCGGCGTGCT
GCTGGCGCTGTGGCTGGCGACCGTGCTCTGGAAACGCTGGCGCGCGCGCCGGGCGAGCGCCGGACTCGAA
GGCGTGCTGGAGCAGGCGGCCGACAAGACCGCCGCGCCGGACAAGCGCGAGGAAGTCGAAGCGCTGCGCG
TGCGCCTGGCCGAGGCGGTCAAGACCATCAAGCGCTCCAAGCTCGGGCAGCTGTCGGGCGATGCGGCCCT
CTATGAGCTGCCCTGGTACATCGTGATCGGCAACCCGGCGGCCGGCAAAAGCACCGCGGTGCTGAACTCG
GGCCTGCAGTTTCCGTTCGCCGACAAGGGCGGCGCGGTGATCCAGGGCATCGGCGGCACGCGCAACTGCG
ACTGGTTCTTCACCACCGAAGGCATCCTGCTCGACACGGCCGGCCGCTACTCGGTGCACGAGGAAGACCG
CCGCGAATGGCTCGGCTTCCTCGACCTGCTCAAGCGCTACCGCCCCAAGGCGCCGATCAACGGCATCGTC
GTGACGGTGAGCGTGTCGGAGCTCACGCAGAACCGTCCCGAGTTCGCCATCAACCTCGCCAAGAACCTGC
GCCAGCGCGTGCAGGAGTTGACCGAGCGGCTGGAAGTGTTCGCTCCGGTCTACGTGATGTTCACCAAGGC
CGACCTGATCACCGGCTTCACGGAATTCTTCGGCGACAGCGAGAAGCAGGAGCGTGACCGCGTATGGGGT
GCCTCCCTGCCCTTCGAGCCGGACGCCAAGCCCGACGTGGCGGCGCTGTTCGATCAGCGCTTCGATGAAC
TGTGCGACGGGCTGAAGGAGATCAGCGTGGCGCAGATCTCGCTGCACCAGAAGAACAAGCTGTCGCCGGG
GCTGCTGAGCTTTCCGCTGGAGTTCGCCTCGATCAAGCCGGCGCTGCGCAGCTTCCTGGTAACGCTGTTC
GACGAGAACCCCTTCCAGTACAAGCCGGTGTTCCGCGGCTTCTACTTCACCAGCGCGCTGCAGGAAGGCG
CCACCAACAGCGCCTCGGCCGAGCGCATCGCGCGCCGCTTCGGGCTCAGCACGGACGGTGCCGCGCGCAG
CCGCGAGGTGTTCTCCAAGAACGGCTTCTTCCTGCGCGACCTGTTCTCCAAGGTCATCTTTTCCGACCGC
CAGACCGTGCGGCAATTCGCCAGCCCGGCCAAGACGCGCCTGCGCATCGCCACCTTCTTCGGGCTGGTGC
TGGCGTTGGGCCTGCTGCTGGGCGGCTGGACGTGGTCGTACATGGGCAACCGCACGCTGACCGCCAACGT
GCAGGCCGACCTCGACAAGATCGTCAAACTGCAGCAGAACCGCGTCGACCTGCAAGCCCGGCTGGAAGCG
CTGGACATCCTGCAGGACCGCATCGAACAGCTCGAGCGCTTCCGCGGCGAGCATCCGCTGGCGCTGTCGC
TGGGGCTGTACCAGGGCGACGCGCTGCAGCACAAGCTGCTCGACGAGTACTACAACGGCCTGCGCCAGGT
GATGCTCAAGCCGGTGGGCGGCGCGCTCGAGACCTTCCTGGCCGAGGTCAACACGCACCCCGAACAGCTC
GCGCCGATGGTGCGTCCGCCCGAGACCGGCGCGGTGATCGCCACCTCCGTGACCTCGGCGACGGCCACCA
TCGCAGCCTCGAGCGCCACCGCCAGTGCGCCGGCATCGCCCACGGCCACGACCACCGCAGCGGCCGGCAA
GCGCTTCACCGATGCCTCGCCCTCCAACGTGGAAGACGGCTACAACGCGCTCAAGACCTACCTGATGCTG
TCGGACAAGCGCCACGTGGAAGTCGCGCACCTGACCGACCAGATCACGCGCTTCTGGCGCGGCTGGCTGG
AAGACAACCGGGGCAACATGCCGCGCGAGCAGATGATCCGCTCGGCCGAGCGCAACCTGTCGTTCTTCCT
GGCCCGCGTGAATGACGACAACTGGCCGCTGCTGGAAGGCAACCTGTCGCTGATCGACCAGACCCGCGAG
AACCTGCGCCGCGTGGTGCGCGGCATGCCGGCGCGCGAACGCGCGTACGCCGAGATCAAGGCCCGCGCCT
CGACCCGCTATGCGCCGATGACGGTCGCGCGCATCGTCGGCGAGACCGGCGGCAACGTGATCGCCGGCAG
CTACGCCGTGCCCGGCACCTTCACCAAGGAGGCGTGGCAGGGCTACGTGCAGCCCGCCATCCGCGAGGCC
GCCAGCAAGGAGCTGCAGACCAAGGACTGGGTGCTCAACGTCGCCGCCCGCGACGACCTGACGCTCGAAG
GCAGCCCCGAGCAGATCCAGAAGACCCTGGTCACGATGTACAAGACCGAGTACGCCCGCGAGTGGCAGCG
CTTCATGCAAGGCGTGGCCGTGCAGGACTTCACCAGCTTCGAGCAGGCCGTGGCCGGCATGAACCTGCTG
GGCGATCCGACCAACTCGCCGATCCGCAAGGTGCTCGACACCGCCTATGACCAGACCTCGTGGGACAACC
CGTCCATGCTCAACGCCGGCCTGAAGCAGGCCAAGTCGGGCGCGCTGGGCTGGTTCAAGCAGTTCTTCTC
GCGGCAGACGCCGTCGCAGATCAACGTCAACGTGGACGTGGGTGGCAACGCCGAGGCCGGCAGCATCCCG
ATGGGGCCGGTGGGCAAGGAGTTCGCCGGGCTGGCGCGCGTGGCGGTGATGCGCGACGACAAATCGCTGC
TGCGCGGCTACATGGACGCGCTGTCCAAGGTCCGCACCCGCTTCAACCTCATCAAGAACCAGGGCGACCC
CGGCCCCGGCGCGCGCCAGCTGATGCAGCAGACGCTGGACGGCAACGGCTCCGAGCTGGCCGACACCCTC
AAGTACGTCGATGAGCAGATGCTGACCGGCATGACCGACAGCGAACGCCAGACGCTGCGCCCGCTGCTGG
TGCGCCCGCTGCTGCAGTCGTATGCGGTGGTGATCCGGCCGGCCAGCGTGGAGATCAACAAGGTGTGGAA
CGCGCAGGTCTACCAGCCGTTCAGCCAGACGCTGTCCGAGAAGTATCCGTTTTCCGCCAATGCCAAGATC
GAGGCCAGCGCGGCCGAGATCGGCCAGATCTTCGGGCCGGAGGGCGCCATCGCCAAGTTCGCCAACACGA
CCATCGGCCCGCTGTCGGTGCGCCGCGGCGACATGCTGGCGGCCCGCACCTGGGGTGACCTGGGTCTGGC
CTTCGTGCCCGAGTTCACTTCCGGCTTCACGCGCTGGATCGCCCCGCTGACGGGCGGTGCGGCGGGCGGC
GCCGGTGGCGCGGCGGCCGCGGCGCCGCAGACAGTGTTCCAGATCCTGCCGGTGCCGTCGCAGGGCACCA
CCGAATACACCATCGAGATCGACGGTCAGCAACTGCGCTACCGCAACACGCCGCCGCAATGGGCCAACTT
CGTCTGGCCGAATCCGCAGGGTGCACCAGGCGCGCGCGTGACGGCCACGACCTTCGACGGCCGCACCGTG
GAGCTGCTCAACGAGCCGGGCCGCTTCGGCCTGGAGCGCCTGATCGCCACCGCGAACCGCAAGCGTCGCC
CCGATGGCGCGTTCGACCTGACGTGGGCGCGCGGCGAGATCAGCGTGTCGGTCAGCCTGCGCATCATCAG
CAGCCCGCAGACGGCCGGTACCGCGGGCTCCGACTCGCCGCAAGGCCAGGGCCTGCGCGGTCTGCGCCTG
CCGACCTCGATCGCGGACGTGGCCGCCTCGCAGAACACCGCCACGCCGCCCGCGCCGGCAGGCAGCCGCC
CGGCCAGCGCGGCCGCCGCCCGGACCCTCGTCACGCAAGAGCAAGGGGGGACGGCGCAATGA
 Primer design