SecReT6
Protein ID: 412339921
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2624
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2841413..2845018 [-]
Producthypothetical protein
NoteTssM
UniProt IDK4QM69
KEGG IDbbh:BN112_2624
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-99, Aligned region: 72..112
ImcF-related_N [PF14331], Evalue: 1.90E-99, Aligned region: 206..470
IcmF-related [PF06761], Evalue: 6.50E-90, Aligned region: 519..829
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 875..889
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 938..1062
Protein Sequence: 1201 a.a.     [Download]
>gi|412339921|ref|YP_006968676.1| hypothetical protein BN112_2624 [Bordetella bronchiseptica 253]
MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLESETARVLVIAALFAFALLRLLWRKWRE
GRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELEGRFDEAVELLRKTRFDGGGGRGWLQRYSRQYLYQLP
WYVIIGAPGSGKTTALVNSGLDFPLAERFGKAALRGVGGTRNCDWWFTDDAVLLDTAGRYTTHESDPTGD
EESWRGFLGLLTRFRGRQPINGAMLTVSIEDLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTK
ADLLAGFEQYFASFSREDLEQVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPEVLAAEPDEAR
RALAYLLPQQFAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGGETFDQVTGHLKRYLRIESGPA
PAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYRRLHWAGYGLITLAFLGLAAGWLASYGNNVRYL
DEVARRVPTVDKLGRDIKITRSGDVLGLMPFLDGLWYLPRDAAFEPDAPPLSYRFGLYQGGKMHAAMQGV
YRGTLDSVLLPQVARRIEAALRAARADDLEYGYEALRAYLMLYEADHYDAEFMHAWLLSDMQGTLPEGYT
RRQYDLMSLHLRQLAQGGVLASPFPRDEALVRQARDELARHTLAQRAYSRLRRMLAGADDQPPTTAVTLG
GPQASAVFVRKSGKPLAQGIAALYTYRGYWDVFNPRVTRVAERLRSDDAWVLDIAPPGVLDEAARQQLIV
DIKRLYLNDYVARWDGYLDDLALAPRSSLLQSIQLARTLSAPDSPLVRLTQGVARETTLLRDAGGDERSL
ADQARDRVSSTREALEQMFGPTGPGAATRADAGDGKLERVVDQHFEPWRRLARADGQGGAPIAATTSLVN
ELYTYLTAADAALRSASPAPASDVVTKLRAEAGRLPRPLRDVLDDLSTGAAGEVSGVARERLGEDLYATI
GLFCRQAIAGRYPFAPGSPRDVAPNDLARLFAPNGMMDEFFQKNLVSQIDVSEARWRFKPGMDGTPGQAS
ALLDSFQRAAAIRDAYFMAGSAEPAFRVSIRPVEMDPAITQFVMDVDGQTVRYAHGPQVATSVQWPGPRG
ANQVRIELTPQAGAAGLSASGPWALNRLLDQARVTRGASPEISLASFDIGGRKVVLEIRAGSVRSPFHLA
EMRGFSCPGRS
 
Nucleotide Sequence: 3606 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2845018-2841413 Bordetella bronchiseptica 253, complete genome
ATGATCCCGCGCCTGTTCGGATGGCTGTTCTCGCGCGGCCTGTGGAGCTTCCTGGGCCTGGTGGCGCTGG
CCCTGCTGGTGTGGATCGCCGGGCCGCTGCTGGCGATCGGCGCGCTGCGCCCGCTGGAAAGCGAGACCGC
GCGCGTACTGGTCATCGCCGCGCTGTTCGCCTTCGCGCTGCTGCGCCTGCTGTGGCGCAAGTGGCGCGAA
GGCCGCCTCAACGCCCAGCTGCTGGGCCAGCTGCGCCGGCCGGCCCGTCCCGAGGCCGAGGCCGCGGCCG
AGCCGCCGCCTTCGGACCTGCGCGAACTGGAAGGCCGTTTCGACGAGGCGGTGGAGCTGTTGCGCAAGAC
GCGCTTCGACGGAGGCGGCGGGCGCGGCTGGCTGCAGCGCTATTCGCGCCAATACCTGTACCAGCTGCCC
TGGTACGTCATCATCGGCGCGCCAGGCTCGGGCAAGACCACGGCCCTGGTCAACTCGGGCCTGGACTTCC
CGCTGGCCGAGCGCTTCGGCAAGGCCGCGCTGCGCGGCGTGGGCGGCACCCGCAACTGCGATTGGTGGTT
CACCGACGACGCGGTGCTGCTCGATACCGCCGGCCGCTACACCACCCATGAAAGCGACCCCACCGGCGAC
GAGGAGTCCTGGCGCGGCTTTCTCGGCCTGTTGACGCGCTTTCGGGGCCGCCAGCCCATCAACGGCGCCA
TGCTCACCGTCAGCATCGAGGACTTGCTGGCCGCGTCCGACGCCGAGCGCGCGCGCCACGCCGCGGTGCT
GCGCCGGCGCCTGCAGGAGCTGCGCGAGCAGCTGGGCATCCATTTCCCGGTCTATGTGCTGGTGACCAAG
GCCGACCTGCTGGCCGGCTTCGAGCAGTACTTCGCCTCGTTCAGCCGCGAAGACCTGGAGCAGGTATGGG
GCTTCACCTTGCCCTATGCGCGCGCCCAGGAGCCGGACTTCGACCTGTACGAAGCCTTTCATGCCGAGTA
CCGGCTGCTGCAGCGCCGGCTCGACGATGCCCTGCCCGAAGTGCTGGCCGCCGAGCCGGACGAGGCGCGC
CGCGCGCTGGCCTACCTGCTGCCGCAGCAGTTCGCCGGCCTGCAGGCCGTGCTGGGCCATTTCCTCAGCG
ACGTGTTCGCCAGCTCGCGCTTCGAGGAGCGCCTGGTGCCGCGCGGCGTGTACTTCACCAGCGGCACCCA
GGGCGGCGAGACCTTCGACCAGGTCACCGGCCACCTCAAGCGCTATCTGCGCATCGAAAGCGGGCCGGCC
CCGGCCGCCGCCGAGGAAGGCCGCAGCTTCTTCCTCAAGCGGCTGCTGCAGGACGTGATCTTTCCCGAGG
CCGGCCTGGCCGGCCGCAACCTGCGCTGGGAGCGCCGCTACCGCCGCCTGCACTGGGCCGGCTACGGCCT
GATCACGCTGGCGTTCCTGGGCCTGGCGGCGGGCTGGCTGGCCAGCTACGGCAACAACGTGCGCTATCTC
GACGAAGTGGCGCGCCGCGTGCCGACGGTGGACAAGCTGGGGCGCGATATCAAGATCACCCGCTCGGGCG
ATGTGCTGGGCCTGATGCCCTTCCTGGACGGCCTGTGGTACCTGCCGCGCGACGCCGCCTTCGAGCCGGA
CGCGCCGCCGCTGTCCTATCGCTTCGGGCTGTACCAGGGCGGCAAGATGCACGCCGCGATGCAGGGCGTT
TATCGCGGCACGCTCGACAGCGTCCTGCTGCCGCAGGTGGCGCGCCGCATCGAGGCGGCGCTGCGCGCGG
CCCGCGCCGACGACCTGGAGTACGGCTACGAGGCCCTGCGCGCCTACCTGATGCTGTACGAGGCCGACCA
CTACGACGCCGAGTTCATGCACGCCTGGCTGCTGTCCGACATGCAGGGCACGCTGCCCGAGGGCTACACG
CGCCGGCAGTACGACCTGATGTCGCTGCACCTGCGCCAGCTGGCGCAGGGCGGCGTGCTGGCCTCGCCGT
TTCCGCGCGACGAGGCGCTGGTGCGGCAGGCGCGCGACGAACTGGCGCGCCACACGCTGGCGCAGCGCGC
CTACAGCCGGCTGCGCCGCATGCTGGCCGGCGCCGACGATCAGCCGCCGACCACCGCGGTGACGCTGGGC
GGGCCGCAGGCCAGCGCCGTCTTCGTGCGCAAGAGCGGCAAGCCGCTGGCCCAGGGCATCGCGGCGCTGT
ACACCTACCGCGGCTATTGGGACGTGTTCAATCCGCGCGTCACGCGCGTGGCCGAGCGCCTGCGCAGCGA
CGATGCCTGGGTCCTGGACATCGCGCCGCCGGGCGTGCTCGACGAGGCCGCGCGCCAGCAGCTCATCGTC
GACATCAAGCGCCTGTACCTCAACGACTACGTGGCGCGCTGGGACGGCTACCTGGACGACCTGGCGCTGG
CGCCGCGCAGCTCGCTGCTGCAAAGCATCCAGCTGGCGCGCACCCTGTCGGCGCCCGATTCGCCGCTGGT
GCGGCTGACCCAGGGCGTGGCGCGCGAGACCACGCTGCTGCGCGACGCGGGCGGCGACGAGCGCTCGCTG
GCGGACCAGGCGCGCGACCGCGTCAGCAGCACGCGCGAGGCGCTGGAGCAGATGTTCGGCCCGACCGGCC
CGGGCGCGGCCACGCGCGCCGACGCCGGCGACGGCAAGCTGGAGCGCGTGGTCGACCAGCACTTCGAGCC
ATGGCGCAGGCTGGCGCGCGCCGACGGGCAGGGCGGCGCGCCGATTGCCGCCACCACCAGCCTGGTCAAC
GAGCTGTACACCTATCTGACGGCGGCCGACGCGGCTCTGCGCAGCGCCAGCCCGGCGCCCGCCTCCGATG
TGGTGACCAAGCTGCGCGCCGAGGCTGGCCGCCTGCCGCGGCCCTTGCGCGACGTGCTCGACGACTTGTC
CACCGGCGCGGCGGGCGAAGTGTCCGGCGTGGCGCGCGAGCGGCTGGGCGAAGACCTGTACGCCACCATC
GGTCTGTTCTGCCGCCAGGCCATCGCCGGCCGCTATCCTTTCGCGCCCGGCTCGCCGCGCGACGTCGCGC
CCAATGACCTGGCGCGGCTGTTCGCGCCCAACGGCATGATGGACGAGTTCTTCCAGAAGAACCTGGTCAG
CCAGATCGATGTGTCCGAGGCGCGCTGGCGCTTCAAGCCGGGCATGGACGGCACGCCGGGCCAGGCGTCG
GCGCTGCTGGATTCGTTCCAGCGCGCCGCCGCGATCCGCGACGCCTATTTCATGGCCGGCAGCGCGGAGC
CGGCCTTTCGCGTCTCGATCCGTCCGGTGGAAATGGACCCGGCCATCACGCAATTCGTCATGGACGTGGA
CGGCCAGACCGTGCGCTATGCGCATGGCCCGCAGGTCGCCACCTCCGTGCAATGGCCGGGGCCGCGCGGC
GCCAACCAGGTGCGCATCGAGCTGACGCCCCAGGCCGGCGCGGCGGGCCTGTCGGCCAGCGGACCGTGGG
CGCTCAATCGCCTGCTCGACCAGGCCCGCGTCACGCGCGGCGCCTCGCCCGAGATCTCGCTGGCCAGCTT
CGATATCGGCGGCCGCAAAGTGGTGCTGGAGATTCGCGCGGGCAGCGTCAGGAGCCCCTTTCACCTGGCC
GAGATGCGGGGTTTTTCCTGCCCGGGCCGTTCATGA
 Primer design