SecReT6
Protein ID: 412339922
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2625
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2845015..2846295 [-]
Productouter membrane protein
NoteTssL
UniProt IDK4QF79
KEGG IDbbh:BN112_2625
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-75, Aligned region: 36..241
OmpA [PF00691], Evalue: 7.70E-14, Aligned region: 305..403
RskA [PF10099], Evalue: 0.003, Aligned region: 179..298
RskA [PF10099], Evalue: 0.003, Aligned region: 363..387
Protein Sequence: 426 a.a.     [Download]
>gi|412339922|ref|YP_006968677.1| outer membrane protein [Bordetella bronchiseptica 253]
MHAANPPFPDFGADAAADPGAASRLRPHEYVISGSNPLVAAANPLLDLIPQIRATTAHPAPAMLREYLVD
EVRQFELRAQQAGIPNETILGARYCLCTALDEAAALTPWGGGGVWSAHSLLVTFHNETWGGEKFFQLLAK
LSQNPGQHLDLLELLYYCLLLGFEGRYRVIDNGRTQLETLRQRLLRILRGARGEYPRALSPHWRDTPVQQ
ALRRLPVPLWAYGALAAALALALFWGLSWRLGERSDAVFAAVARLKPPTVQIAPAPRPAPAPRLAVFLQP
EVRDRLVTVRDEVDRSVVVLRGDGLFESGAVAVRDRYAPVLARVAEALGQTRGDIVVRGYTDNVPIRTAR
FPSNWHLSQARAEAVKAVIDARLGQAGRVRAEGRGEADPLAPNDTPAGRSVNRRVEITVMVPPAPHARTP
EEGATP
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2846295-2845015 Bordetella bronchiseptica 253, complete genome
ATGCACGCCGCCAACCCTCCCTTTCCCGACTTCGGCGCCGACGCGGCGGCCGACCCCGGCGCGGCCAGCC
GGCTGCGCCCGCACGAGTACGTCATCAGCGGCTCCAACCCGCTGGTGGCGGCGGCCAATCCGCTGCTGGA
CCTGATCCCGCAGATCCGCGCCACCACGGCCCATCCCGCGCCGGCCATGCTGCGCGAGTACCTGGTCGAC
GAAGTGCGCCAGTTCGAGCTGCGCGCGCAACAGGCCGGCATTCCCAACGAAACCATCCTGGGCGCGCGCT
ACTGCCTGTGCACGGCGCTGGACGAGGCCGCCGCGCTCACGCCGTGGGGCGGGGGCGGCGTATGGTCGGC
GCACAGCCTGCTGGTGACGTTCCATAACGAAACCTGGGGCGGCGAGAAGTTCTTCCAGCTGCTGGCCAAG
CTGTCGCAGAACCCGGGCCAGCACCTGGATTTGCTGGAGCTGCTGTACTACTGCCTGCTGCTGGGCTTCG
AGGGCCGCTACCGCGTCATCGACAACGGCCGCACGCAGCTCGAGACCTTGCGCCAGCGCCTGCTGCGCAT
CCTGCGCGGCGCGCGCGGCGAGTATCCGCGCGCGCTCTCGCCGCATTGGCGCGACACGCCGGTGCAGCAG
GCGCTGCGCCGCCTGCCGGTGCCGCTGTGGGCCTACGGGGCGCTGGCGGCGGCGCTGGCGCTGGCGTTGT
TCTGGGGCCTGTCGTGGCGCCTGGGCGAACGCTCGGATGCCGTGTTCGCCGCGGTCGCGCGGCTCAAGCC
GCCCACGGTGCAGATCGCCCCGGCGCCGCGCCCGGCGCCCGCGCCCCGCCTGGCCGTGTTCCTGCAACCC
GAGGTGCGCGACCGCCTGGTGACGGTGCGCGACGAGGTCGATCGCAGCGTGGTGGTGCTGCGCGGCGACG
GGCTGTTCGAATCGGGCGCGGTCGCGGTGCGCGACCGCTATGCGCCGGTGCTGGCGCGGGTGGCCGAGGC
GCTGGGCCAGACGCGCGGCGATATCGTGGTGCGCGGCTATACCGACAACGTTCCCATCCGCACGGCGCGC
TTTCCGTCCAACTGGCATCTGTCGCAGGCGCGCGCCGAGGCGGTCAAGGCGGTGATCGACGCGCGCCTGG
GCCAGGCCGGACGCGTGCGCGCAGAAGGGCGCGGCGAGGCCGATCCGCTGGCCCCCAATGACACCCCCGC
CGGACGCTCGGTCAACCGGCGGGTCGAAATTACCGTGATGGTGCCGCCGGCGCCGCATGCCCGCACGCCC
GAAGAAGGAGCCACGCCATGA
 Primer design