SecReT6
Protein ID: 412339923
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2626
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2846316..2847650 [-]
Producthypothetical protein
NoteTssK
UniProt IDK4QM37
KEGG IDbbh:BN112_2626
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.40E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|412339923|ref|YP_006968678.1| hypothetical protein BN112_2626 [Bordetella bronchiseptica 253]
MALDNKVVWSEGMFLRPQHFQQFERHIEAQLRVRAAAASGCGWGYTALEIDRDALALGKLALARAAGVLP
DGTPFEFERADEGPPALDIDPAMRDARVMLALPRRRAGACEVVYEDGADTLARYCVHEGEIEDSGSVGLE
PALVQLGRLRLRLVPETELGDEWVALGAARVLERRADHRVVLDEMYIPPWLAADANPALRGYAGELSGLL
QARAAALAQRLAQPGRGGVSEVADFLLLALVNRYAGALWHARQVPALHPERLFRDWLMLACDLATYTCAT
RLPEVLPDYRHDDLQASFGPLMAELRRSLSVVLEQHAVQIPLHDRGQGVRVAQIADAELLRSAGFVLAVH
ADMPAETVRTRFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPYSAGHVYFELDKNGEFWRQLER
TGALALHLAGEFPGLALEFWAVRD
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2847650-2846316 Bordetella bronchiseptica 253, complete genome
ATGGCACTGGACAACAAGGTCGTCTGGTCGGAGGGCATGTTCCTGCGGCCGCAACATTTCCAGCAGTTCG
AACGGCATATCGAGGCGCAGTTGCGCGTGCGCGCCGCGGCGGCCTCGGGCTGCGGCTGGGGCTACACCGC
GCTGGAGATCGATCGCGACGCGCTGGCGCTGGGCAAGCTGGCGCTGGCGCGCGCCGCGGGCGTGCTGCCC
GACGGCACGCCGTTCGAGTTCGAGCGCGCCGACGAGGGGCCGCCGGCGCTGGACATCGACCCGGCCATGC
GCGATGCGCGCGTGATGCTGGCGCTGCCGCGCCGCCGCGCCGGCGCCTGCGAAGTGGTCTACGAAGACGG
CGCGGATACGCTGGCGCGCTATTGCGTGCATGAAGGCGAGATCGAGGACTCCGGCTCGGTGGGCCTGGAG
CCGGCGCTGGTGCAGCTGGGCCGTTTGCGCCTGCGGCTGGTTCCCGAAACCGAGCTGGGCGACGAATGGG
TGGCGCTGGGCGCCGCGCGGGTGCTGGAGCGCCGCGCCGACCACCGCGTGGTGCTCGACGAGATGTACAT
CCCGCCCTGGCTGGCCGCCGACGCCAATCCGGCGCTGCGCGGCTATGCCGGCGAGCTGTCCGGGCTGCTG
CAGGCGCGCGCAGCGGCGCTGGCGCAGCGGCTGGCGCAGCCGGGCCGCGGCGGCGTCTCCGAAGTGGCCG
ACTTCCTGCTGCTGGCGCTGGTAAACCGCTACGCCGGCGCGCTGTGGCACGCGCGCCAGGTGCCGGCCCT
GCATCCCGAACGGCTGTTTCGCGACTGGCTGATGCTGGCCTGCGACCTGGCCACCTATACCTGCGCCACG
CGCCTGCCCGAGGTGCTGCCCGATTACCGCCACGACGACCTGCAGGCCAGTTTCGGGCCGCTCATGGCCG
AGCTGCGCCGCTCGCTGTCGGTGGTGCTGGAGCAGCACGCCGTGCAGATCCCGCTGCATGACCGCGGCCA
GGGCGTGCGCGTGGCGCAGATCGCCGATGCCGAACTGCTGCGCAGCGCCGGCTTCGTGCTGGCCGTGCAC
GCCGACATGCCGGCCGAGACGGTGCGCACGCGCTTTCCGGCCCAGGTCAAGATCGGCCCGGTCGAGCGCA
TCCGCGACCTGGTGCATCTGCAATTGCCCGGCGTGGCGGTGCGCGCCCTGCCGGTGGCGCCGCGCCAGAT
TCCCTACAGCGCGGGCCACGTGTACTTCGAGCTGGACAAGAACGGCGAGTTCTGGCGGCAGCTGGAGCGC
ACCGGCGCGCTGGCCCTGCACCTGGCGGGCGAGTTTCCCGGCCTGGCGCTGGAGTTCTGGGCCGTGCGCG
ACTGA
 Primer design