SecReT6
Protein ID: 412339924
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2627
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2847696..2848238 [-]
Productlipoprotein
NoteTssJ
UniProt IDK4QLM7
KEGG IDbbh:BN112_2627
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-39, Aligned region: 21..167
Protein Sequence: 180 a.a.     [Download]
>gi|412339924|ref|YP_006968679.1| lipoprotein [Bordetella bronchiseptica 253]
MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADPRVNPDASGRPSPIQVTLYELRSSAE
FEARDFFTLQGDAQAALGKSLIETDQVILQPGETRKLSYPGNTEARVVGIVAAYRDLERSPWRIVVPLPQ
AQNTNIYKFWQFSPNEETVRVAVGGQGVQIVDRERSWWPF
 
Nucleotide Sequence: 543 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2848238-2847696 Bordetella bronchiseptica 253, complete genome
TTGCTTGTTGCTGTGCCCACGCGGCGCGCGTTGCGCGCGGCGGCCTGGATTGCCGTCGCGGTGCTGGCCG
CCGGGTGCGCGTCCACGGCCAGCCGCAAGGCGGCGCCTTACGCGATCGAGCTGAAGGCCGATCCGCGCGT
CAATCCCGATGCCTCGGGCCGGCCCTCGCCGATCCAGGTCACGCTGTACGAGCTGCGTTCGTCCGCCGAG
TTCGAGGCGCGCGATTTCTTCACCCTGCAAGGCGACGCGCAGGCCGCGCTGGGCAAGTCGCTCATCGAAA
CCGACCAGGTCATCCTGCAGCCCGGCGAAACCCGCAAGCTGTCGTATCCGGGCAATACCGAGGCGCGCGT
GGTCGGCATCGTGGCGGCCTATCGCGACCTCGAGCGCAGTCCCTGGCGCATCGTCGTGCCCCTGCCGCAG
GCCCAGAACACCAACATCTACAAGTTCTGGCAGTTCTCGCCCAACGAGGAGACCGTGCGCGTCGCGGTGG
GCGGACAGGGCGTGCAAATCGTCGACCGGGAGCGTTCCTGGTGGCCCTTCTGA
 Primer design