SecReT6
Protein ID: 412339926
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2629
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2848926..2849726 [+]
Producthypothetical protein
NoteFha
UniProt IDK4QM73
KEGG IDbbh:BN112_2629
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0028, Aligned region: 27..94
Protein Sequence: 266 a.a.     [Download]
>gi|412339926|ref|YP_006968681.1| hypothetical protein BN112_2629 [Bordetella bronchiseptica 253]
MMLTLIVRNPEPGASARRADFHAPGGTLGRDAENCLALPAAPGQLCRVQAALRADAQGWRLHNLSGMAAV
HINDAALAPGAVRAIQAGDTLRVGAHTLEVSGPDAPDARPAALPEAAADTPADAPRRGQAGAGAAEDIFS
GLFGPGTLPVGGTADAATHPFDLDSAQARNAADPLAHLPAGDAAVSRPAGDPLALFDAPHGGADVFADAT
PSALPAHDPLAPLRADPVRDTLLPRHAAGDGPAAHDHAPAGGTFLRPAAPRADQAD
 
Nucleotide Sequence: 801 bp     [Download]
>gi|412337338|ref|NC_019382.1|:2848926-2849726 Bordetella bronchiseptica 253, complete genome
ATGATGCTGACGCTGATCGTACGCAACCCCGAGCCTGGCGCAAGCGCGCGCCGGGCGGATTTCCACGCGC
CCGGCGGCACGCTGGGCCGCGACGCCGAGAATTGCCTGGCCCTGCCGGCCGCGCCCGGCCAGCTATGCCG
CGTGCAGGCCGCGCTGCGCGCCGACGCGCAAGGCTGGCGCCTGCACAACCTGAGCGGCATGGCCGCGGTG
CACATCAACGACGCGGCGCTCGCGCCCGGCGCCGTGCGCGCCATCCAGGCGGGCGATACGCTGCGCGTGG
GCGCGCACACGCTGGAGGTGAGCGGGCCCGATGCGCCCGACGCACGGCCGGCAGCACTGCCCGAGGCGGC
GGCGGACACGCCCGCCGATGCGCCCCGGCGCGGGCAAGCCGGCGCCGGGGCGGCCGAGGACATATTCAGC
GGCCTGTTCGGCCCCGGCACCCTGCCGGTGGGCGGCACCGCCGATGCTGCCACGCACCCCTTCGACCTGG
ATTCGGCGCAGGCGCGCAACGCCGCCGATCCGCTGGCGCATCTGCCGGCCGGCGACGCCGCGGTCAGCCG
CCCGGCGGGCGACCCGCTGGCGCTGTTCGACGCGCCGCATGGCGGCGCGGACGTGTTCGCCGACGCCACC
CCGTCGGCCCTGCCCGCGCACGATCCGCTGGCGCCGCTGCGCGCCGACCCGGTGCGCGACACGCTGCTGC
CGCGCCACGCGGCCGGCGACGGCCCGGCCGCGCACGACCATGCGCCGGCGGGAGGCACCTTCCTGCGCCC
GGCCGCGCCGCGCGCGGACCAGGCGGACTGA
 Primer design