SecReT6
Protein ID: 412339927
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2630
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2849782..2852391 [-]
ProductATPase
NoteTssH
UniProt IDK4QF82
KEGG IDbbh:BN112_2630
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.50E-37, Aligned region: 221..300
AAA_2 [PF07724], Evalue: 2.50E-37, Aligned region: 601..767
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 222..353
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 607..690
ClpB_D2-small [PF10431], Evalue: 4.60E-14, Aligned region: 774..848
AAA_5 [PF07728], Evalue: 5.80E-13, Aligned region: 222..249
AAA_5 [PF07728], Evalue: 5.80E-13, Aligned region: 606..716
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 62..72
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 199..244
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 267..301
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 476..569
AAA_16 [PF13191], Evalue: 2.70E-10, Aligned region: 576..651
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 222..302
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 354..388
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 526..565
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 605..629
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 667..690
Sigma54_activat [PF00158], Evalue: 2.30E-08, Aligned region: 208..300
Sigma54_activat [PF00158], Evalue: 2.30E-08, Aligned region: 376..393
Sigma54_activat [PF00158], Evalue: 2.30E-08, Aligned region: 606..706
Clp_N [PF02861], Evalue: 3.20E-07, Aligned region: 26..75
Clp_N [PF02861], Evalue: 3.20E-07, Aligned region: 111..135
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 24..106
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 222..277
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 605..642
IstB_IS21 [PF01695], Evalue: 6.90E-06, Aligned region: 204..244
IstB_IS21 [PF01695], Evalue: 6.90E-06, Aligned region: 606..626
AAA_18 [PF13238], Evalue: 2.90E-05, Aligned region: 222..256
AAA_18 [PF13238], Evalue: 2.90E-05, Aligned region: 607..635
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 222..254
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 606..634
Zeta_toxin [PF06414], Evalue: 5.30E-05, Aligned region: 220..243
Zeta_toxin [PF06414], Evalue: 5.30E-05, Aligned region: 467..506
Zeta_toxin [PF06414], Evalue: 5.30E-05, Aligned region: 597..646
AAA_14 [PF13173], Evalue: 8.10E-05, Aligned region: 222..302
AAA_14 [PF13173], Evalue: 8.10E-05, Aligned region: 605..693
AAA_29 [PF13555], Evalue: 9.50E-05, Aligned region: 214..238
AAA_29 [PF13555], Evalue: 9.50E-05, Aligned region: 604..631
AAA_19 [PF13245], Evalue: 0.00051, Aligned region: 221..246
AAA_19 [PF13245], Evalue: 0.00051, Aligned region: 371..399
AAA_19 [PF13245], Evalue: 0.00051, Aligned region: 604..631
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 201..237
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 274..305
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 605..627
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 671..688
Hpr_kinase_C [PF07475], Evalue: 0.0047, Aligned region: 222..234
Hpr_kinase_C [PF07475], Evalue: 0.0047, Aligned region: 603..625
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 223..243
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 607..628
DUF815 [PF05673], Evalue: 0.0065, Aligned region: 214..298
DUF815 [PF05673], Evalue: 0.0065, Aligned region: 601..645
NTPase_1 [PF03266], Evalue: 0.008, Aligned region: 222..244
NTPase_1 [PF03266], Evalue: 0.008, Aligned region: 273..299
NTPase_1 [PF03266], Evalue: 0.008, Aligned region: 606..627
Protein Sequence: 869 a.a.     [Download]
>gi|412339927|ref|YP_006968682.1| ATPase [Bordetella bronchiseptica 253]
MSDIGRAELFGKLDSLSYRALEDATALCKLRGNPYVELAHWVHAIAHAQDSDLHHIARAFELDLGALQQD
LVRALDQLPRGAGAVSDLSEHVDHVVERAWALASLRYGAARIRSGHLLLALLRDPSLRGVLAGMSGQFAR
VVPDLLLQGLPEMTRGSPEARADAAVADAPPDGGGAAGALARYAVDLTAQARAGRLDPVTGRDDEIRQLI
DVLMRRRQNNPLLTGEAGVGKTAVVEGLALRLARGDVPAPLREVALYLLDIGLLQAGAGVKGEFEQRLRQ
VIDAVQGSERPIVLFIDEIHTLVGAGGAAGTGDAANLLKPALARGQLRTIGATTWAEYKQYIEKDPALTR
RFQAIQVHEPDEAGARRMLRGLAGALQAHHGVLLLDEAVEAAVRLSHRYIPARQLPDKAVALLDTACARV
AVSQQATPAALEDARRRIDALDLELEIAAREARLDAGPAERVAGLREQGQAARAEADALAARWEREAALA
GQVFGLREQLDAADEQSAPALRAALREAADALARSQGEAPLIHPAVDAAAVAAVVADWTGIPVGRMVRDE
AQAVLALADTLERRVVGQRHALELIARRIQTARAGLTDPGKPVGVFLLCGPSGVGKTETALALAEALYGG
EQNLITINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPHSVVLLDEVEKAHADVHEIFFQVFD
KGWMEDGEGRYIDFRNTVILLTANVGADLIASLCADPELAPEPDALAAALRAPLRDVFPAALLGRLAAVP
YLPLSDSMLAHIVALQFERVGQRLRERHGMDLEVEPAAAELVVARCVEVESGARMVDAILSQRVLPQIGR
ELLGASLQQRTWRRVRVRAVDGEFACEYE
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2852391-2849782 Bordetella bronchiseptica 253, complete genome
ATGTCCGATATCGGCCGCGCCGAGCTGTTCGGCAAACTCGATTCCCTGTCCTATCGCGCCCTGGAGGACG
CCACCGCCCTGTGCAAGCTGCGCGGCAATCCCTACGTGGAGCTGGCGCACTGGGTGCACGCCATCGCGCA
CGCGCAGGACAGCGACCTGCACCATATCGCGCGCGCGTTCGAGCTGGATCTCGGCGCGCTGCAGCAAGAC
CTGGTGCGCGCGCTCGACCAATTGCCGCGCGGGGCGGGGGCGGTCTCGGACCTCTCCGAGCACGTGGACC
ACGTGGTGGAACGCGCCTGGGCGCTGGCGTCGCTGCGCTACGGCGCTGCGCGCATCCGCAGCGGGCACCT
GCTGCTGGCGCTGCTGCGCGACCCCAGCCTGCGCGGCGTGCTGGCCGGCATGTCGGGGCAGTTCGCCCGC
GTCGTGCCAGACCTGCTGCTGCAAGGCCTGCCCGAGATGACGCGCGGCTCGCCCGAGGCGCGCGCCGACG
CTGCCGTGGCCGATGCGCCGCCGGATGGCGGCGGCGCGGCCGGCGCGCTGGCGCGCTACGCGGTGGACCT
GACCGCCCAGGCGCGCGCCGGCCGGCTCGATCCGGTGACCGGGCGCGACGACGAAATCCGCCAGTTGATC
GACGTGCTGATGCGGCGGCGCCAGAACAATCCCCTGCTCACCGGCGAGGCCGGCGTGGGCAAGACCGCGG
TGGTCGAGGGCCTGGCCCTGCGGCTGGCGCGCGGCGATGTGCCGGCGCCGCTGCGCGAGGTGGCGCTGTA
CCTGCTGGATATCGGGCTGCTGCAGGCCGGCGCCGGCGTCAAGGGCGAGTTCGAGCAGCGCCTGCGCCAG
GTCATCGACGCGGTGCAGGGCAGCGAACGCCCCATCGTGCTGTTCATCGACGAAATCCATACCCTGGTGG
GGGCCGGCGGCGCGGCGGGGACGGGCGATGCCGCCAACCTGCTCAAGCCGGCGCTGGCGCGCGGACAGCT
GCGCACCATCGGCGCCACGACCTGGGCCGAATACAAGCAGTACATCGAGAAAGACCCGGCGCTGACGCGG
CGCTTCCAGGCCATCCAGGTGCACGAGCCCGACGAGGCCGGCGCGCGGCGCATGCTGCGCGGCCTGGCCG
GCGCCCTGCAGGCGCATCATGGCGTGCTGCTGCTGGACGAGGCCGTAGAGGCCGCCGTGCGGCTGTCGCA
TCGCTACATCCCGGCGCGCCAGTTGCCGGACAAGGCGGTCGCCCTGCTCGACACGGCCTGCGCGCGCGTG
GCGGTCAGCCAGCAGGCCACGCCGGCCGCGCTGGAAGACGCGCGCCGCCGCATCGACGCGCTGGATCTCG
AGCTGGAAATCGCCGCGCGCGAGGCGCGGCTGGACGCCGGCCCGGCCGAGCGCGTGGCGGGGCTGCGCGA
GCAGGGCCAGGCGGCGCGCGCCGAGGCCGACGCCCTGGCGGCGCGCTGGGAGCGTGAAGCGGCGCTGGCC
GGCCAGGTGTTCGGCCTGCGCGAACAGCTGGACGCGGCCGACGAGCAGTCCGCGCCGGCCTTGCGCGCCG
CGCTGCGCGAGGCCGCCGACGCGCTGGCGCGCAGCCAGGGCGAGGCGCCGCTGATCCACCCGGCGGTCGA
TGCCGCGGCCGTGGCGGCCGTGGTGGCCGATTGGACCGGCATCCCCGTGGGCCGCATGGTGCGCGACGAA
GCGCAGGCCGTGCTGGCGCTGGCCGACACCCTGGAGCGCCGCGTCGTCGGCCAGCGCCATGCGCTGGAAC
TGATCGCGCGCCGCATCCAGACCGCGCGCGCCGGTCTGACCGACCCGGGCAAGCCGGTCGGCGTGTTCCT
GCTGTGCGGCCCGAGCGGCGTGGGCAAGACCGAGACCGCGCTGGCCCTGGCCGAGGCCCTGTATGGCGGC
GAGCAGAATCTCATCACCATCAACATGAGCGAGTTCCAGGAGTCGCACACGGTGTCGACCCTGAAGGGCG
CGCCGCCGGGCTATGTGGGCTACGGCGAGGGCGGCGTGCTGACCGAAGCGGTGCGGCGCCGCCCGCACAG
CGTGGTGCTGCTCGACGAGGTCGAGAAAGCCCACGCCGACGTGCACGAGATTTTCTTCCAGGTGTTCGAC
AAGGGGTGGATGGAAGACGGCGAAGGCCGTTACATCGATTTCCGCAACACGGTCATCCTGTTGACCGCCA
ACGTGGGCGCGGACCTGATCGCCAGCCTGTGCGCCGACCCCGAGCTGGCGCCCGAGCCCGACGCGCTGGC
GGCGGCCCTGCGCGCGCCGCTGCGCGACGTGTTTCCCGCGGCCTTGCTGGGCCGCCTGGCGGCCGTGCCC
TATCTGCCGCTGTCGGACAGCATGCTGGCGCACATCGTGGCCTTGCAGTTCGAACGCGTCGGCCAGCGCC
TGCGCGAGCGCCACGGCATGGATTTGGAAGTCGAACCGGCCGCCGCCGAGCTGGTGGTGGCGCGCTGCGT
CGAGGTCGAATCCGGCGCGCGCATGGTCGACGCCATTCTGAGCCAGCGCGTCCTGCCGCAGATCGGCCGC
GAATTGCTGGGCGCCTCCCTGCAGCAACGCACCTGGCGCCGCGTGCGCGTGCGGGCGGTCGACGGCGAGT
TCGCCTGCGAGTACGAGTAG
 Primer design