SecReT6
Protein ID: 412339930
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2633
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2853312..2854406 [-]
Producthypothetical protein
NoteTssG
UniProt IDK4QN31
KEGG IDbbh:BN112_2633
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-111, Aligned region: 28..328
Protein Sequence: 364 a.a.     [Download]
>gi|412339930|ref|YP_006968685.1| hypothetical protein BN112_2633 [Bordetella bronchiseptica 253]
MSMDAAARTDRHAAPAVLPPAFWQALAAAPHGHDLFHVLRWIDARAGARAPLGRGASPRHEPVRMRQEPS
LAFAPATLAAARAPGEGAAPELSIYSFGLFGPNGPLPLHLTEHARERRQHHGDHSLAAFADLFHHRLILL
FYRAWADAQSTASLDRGQERFSGYVASLLHLGAPSLRRRDSVMDHAKYHMAGHLLRQTRNPEGLCQVLRA
FFGLPVGVDEFVAQWIRLEAGQRLRLGAGGGLGGGAPLGVAVRDAQHKFRIRLGPLDWQDYLAFLPGSAR
ARQLLHWVRLYVGVEFAWEVRPVLRRDAVRSVRLGAAAPLGLASWLGRRPPRLGDAAELLLDYEGRERQA
ARRAQAFHEKEQAA
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2854406-2853312 Bordetella bronchiseptica 253, complete genome
TTGAGCATGGACGCAGCGGCCAGGACGGATCGACACGCGGCGCCGGCGGTGCTGCCGCCTGCCTTCTGGC
AGGCCCTGGCGGCGGCGCCGCACGGGCACGACCTGTTTCACGTGCTGCGCTGGATCGACGCGCGCGCCGG
CGCGCGCGCGCCGCTGGGCCGCGGCGCCTCGCCGCGCCACGAACCGGTGCGCATGCGGCAGGAGCCTTCG
CTGGCTTTCGCGCCGGCCACCCTGGCCGCGGCGCGCGCGCCGGGCGAGGGCGCCGCGCCCGAGCTGTCCA
TCTACAGCTTCGGCCTGTTCGGTCCCAATGGGCCGCTGCCGCTGCACCTGACCGAGCACGCCCGCGAACG
CCGCCAGCATCACGGCGACCACTCCCTGGCCGCGTTCGCCGACCTGTTCCACCATCGCCTGATCCTGCTG
TTCTACCGCGCCTGGGCCGATGCGCAGTCCACCGCCAGCCTGGACCGCGGCCAGGAGCGCTTCAGCGGCT
ACGTGGCCAGCCTGCTGCACCTGGGCGCGCCGTCGCTGCGCCGGCGCGACAGCGTGATGGACCATGCCAA
GTACCACATGGCCGGCCATCTGCTGCGCCAGACCCGCAACCCGGAAGGCCTGTGCCAGGTGCTGCGCGCC
TTCTTCGGCCTGCCCGTGGGGGTAGACGAGTTCGTGGCGCAGTGGATAAGGTTGGAGGCCGGCCAGCGGC
TGCGGCTGGGGGCGGGCGGCGGGCTGGGCGGCGGCGCGCCCCTGGGCGTGGCCGTGCGCGACGCCCAGCA
CAAGTTCAGGATCCGCCTCGGGCCGCTGGACTGGCAGGACTACCTGGCGTTCCTGCCCGGTTCGGCCCGC
GCGCGCCAGCTGCTGCATTGGGTGCGCCTGTATGTGGGCGTGGAGTTCGCCTGGGAGGTGCGGCCGGTGC
TGCGCCGCGACGCGGTGCGCAGCGTGCGCCTGGGCGCGGCGGCGCCGCTGGGGCTGGCGTCCTGGCTGGG
CCGGCGGCCGCCGCGCCTGGGCGACGCCGCCGAGCTGTTGCTGGACTACGAGGGGCGCGAGCGCCAGGCG
GCGCGGCGCGCGCAAGCGTTTCATGAAAAGGAGCAAGCGGCATGA
 Primer design