SecReT6
Protein ID: 412339932
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2635
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2855097..2857010 [-]
Producthypothetical protein
NoteTssF
UniProt IDK4QF87
KEGG IDbbh:BN112_2635
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-211, Aligned region: 5..636
Protein Sequence: 637 a.a.     [Download]
>gi|412339932|ref|YP_006968687.1| hypothetical protein BN112_2635 [Bordetella bronchiseptica 253]
MDARLLDYYNRELVYMRELGAEFARQHPKVAGRLGMHGTEVADPYVERLLEGFSFLAARIHLKMDAEFPR
FTQRLLEVVHPHYLAPTPAMAVAQFSPSMNEGTLAGGFTLPRGTVLRGGLARGEQTPCEFMTGHALRLWP
LRVTAAELTGAPTDLPLARLGLGGREAGVASALRLRLEVCGGVSLEELDLDQLVFYLNGPDAPMQRLLEL
IMCHTVAVLGHDSERPVSWINRLPADAVRHEGFADDQALLPTDTRVFQGYRLLQEYFAFARRYLFFSLNG
LKQGLCTRRAAPAAAAGPAGTRRFDLTLLLSAAAPELEGAISAGNLALHCAPIVNLFPRRADRVAVTPRH
HEYHVVVDRTRPLDFEVYSMTRVLGHMSAQRPEQEFRPFYGSFGADADDYGAYYSLRREPRLASDSARRH
GTRTSYTGSEVYLSLVDRHEAPFADTLRHLGIDALCTNRDLALLLPLSGASDFSLRVSAPVGAIKVLHGP
SRPAAAMADHGTAWQLISHLGLHYHSLTDLDETRGAQTLRELLNLYGNLADPVARKHISGVRHVRVEPMH
HRLPVPGPIVYGRGVRIDLQVDETAFSGISPYLFGAVLEQFFARHVSINMMSALTLSTPQRGAVASWRPR
MGRRPAV
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2857010-2855097 Bordetella bronchiseptica 253, complete genome
ATGGACGCGCGCCTGCTCGACTACTACAACCGCGAGCTGGTCTATATGCGCGAGCTGGGCGCCGAGTTCG
CGCGCCAGCATCCCAAGGTGGCGGGGCGGCTGGGCATGCACGGCACCGAGGTGGCCGACCCGTACGTCGA
GCGCCTGCTCGAAGGCTTCAGCTTCCTGGCCGCGCGCATCCACCTGAAGATGGACGCCGAGTTTCCGCGC
TTCACGCAGCGGCTGCTGGAGGTGGTGCATCCGCACTATCTCGCGCCCACCCCGGCGATGGCGGTGGCGC
AGTTCTCGCCCAGCATGAACGAAGGCACGCTGGCCGGCGGCTTTACCCTGCCGCGCGGCACCGTGCTGCG
CGGCGGCCTGGCGCGTGGCGAACAGACGCCGTGCGAGTTCATGACCGGCCACGCGCTGCGGCTGTGGCCG
CTGCGCGTGACGGCGGCCGAACTCACCGGCGCGCCCACCGACCTGCCGCTGGCCCGCCTGGGCCTGGGCG
GACGCGAGGCCGGCGTGGCCAGCGCGCTGCGCCTGCGGCTGGAAGTCTGCGGCGGCGTCAGCCTGGAAGA
GCTGGACCTGGATCAACTGGTGTTCTACCTCAACGGGCCGGACGCGCCCATGCAGCGCCTGCTGGAGCTG
ATCATGTGCCACACGGTCGCCGTGCTGGGCCACGACAGCGAGCGGCCCGTCTCGTGGATCAACCGGCTGC
CGGCCGACGCGGTGCGCCACGAGGGGTTCGCCGACGACCAGGCGCTGCTGCCCACCGACACGCGGGTCTT
CCAGGGCTATCGGCTGCTGCAGGAGTACTTCGCGTTCGCGCGCCGCTATCTGTTCTTCAGCCTGAACGGC
CTGAAGCAGGGCCTGTGCACGCGGCGCGCGGCGCCGGCCGCGGCGGCTGGCCCGGCCGGCACCCGGCGTT
TCGACCTGACGCTGCTGCTGTCGGCCGCAGCGCCCGAGCTCGAAGGCGCGATCTCGGCCGGGAACCTGGC
GCTGCACTGCGCGCCCATCGTCAACCTGTTTCCGCGCCGCGCCGACCGCGTGGCGGTCACGCCGCGCCAC
CACGAGTACCACGTGGTGGTCGACCGCACCCGGCCGCTGGACTTCGAGGTCTACAGCATGACGCGGGTGC
TCGGCCATATGTCGGCGCAGCGCCCCGAACAGGAGTTCCGTCCGTTCTACGGCTCGTTCGGCGCGGACGC
CGACGATTACGGCGCCTATTACTCGTTGCGGCGCGAGCCGCGGCTGGCCTCGGACAGCGCGCGCCGCCAT
GGCACGCGCACCAGCTATACCGGCAGCGAAGTCTATCTGTCGCTGGTCGATCGGCACGAGGCGCCGTTTG
CCGATACGCTGCGCCATCTCGGCATCGACGCGCTGTGCACCAACCGCGACCTGGCGCTGCTGCTGCCGCT
GAGCGGCGCCAGCGATTTCAGCCTGCGCGTGTCCGCCCCGGTGGGCGCGATCAAGGTGCTGCATGGGCCG
TCGCGGCCGGCCGCGGCCATGGCCGACCACGGCACGGCATGGCAATTGATCAGCCACCTGGGGCTGCACT
ACCACAGCCTGACCGACCTGGACGAGACGCGCGGCGCGCAGACGCTGCGCGAGCTGCTCAACCTGTACGG
CAACCTGGCCGATCCGGTGGCGCGCAAGCATATCTCGGGCGTGCGCCACGTGCGGGTCGAACCCATGCAC
CACCGCCTGCCCGTGCCCGGCCCCATCGTCTACGGCCGCGGCGTGCGCATCGACCTGCAGGTCGACGAGA
CCGCCTTCTCGGGCATCAGCCCCTACCTGTTCGGCGCGGTGCTGGAGCAGTTCTTCGCGCGCCACGTCTC
CATCAACATGATGTCGGCGCTCACCCTGTCCACGCCGCAGCGCGGCGCCGTGGCGAGCTGGCGGCCCCGC
ATGGGCCGCCGTCCCGCGGTCTAG
 Primer design