SecReT6
Protein ID: 412339933
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2636
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2857010..2857528 [-]
Producthypothetical protein
NoteTssE
UniProt IDK4QM44
KEGG IDbbh:BN112_2636
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-20, Aligned region: 41..150
Protein Sequence: 172 a.a.     [Download]
>gi|412339933|ref|YP_006968688.1| hypothetical protein BN112_2636 [Bordetella bronchiseptica 253]
MRIADERVARDRLQPSLLDRLVDDEPWRRSEAPEAALLTYAGLRAAVLRDLRWLLNTVNLASSQDLAPYR
HVPASSVNFGVRAMAGRRMSEIDWVDVETSIRDAIAAFEPRILESSVEVRCVSDTRTLEHHNVLSLEIRG
MLWCVPHPREFLFRTDIDLESGHMDLRDLGGA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2857528-2857010 Bordetella bronchiseptica 253, complete genome
ATGAGAATCGCCGACGAACGGGTGGCGCGCGACCGCCTGCAGCCGTCGCTGCTCGATCGCCTGGTCGATG
ACGAGCCATGGCGCCGCAGCGAGGCGCCCGAAGCGGCGCTGTTGACGTACGCCGGGCTGCGCGCCGCGGT
ACTGCGCGACCTGCGCTGGCTGCTCAACACGGTCAACCTCGCCTCGTCGCAGGATCTGGCGCCGTACCGG
CACGTGCCCGCCTCCAGCGTCAATTTCGGCGTGCGCGCCATGGCCGGACGCCGCATGTCGGAGATCGACT
GGGTCGATGTCGAGACGTCGATCCGCGACGCCATCGCGGCGTTCGAGCCGCGCATCCTGGAATCCTCGGT
TGAGGTGCGCTGCGTCAGCGACACCCGCACGCTCGAGCACCACAATGTGCTCAGCCTGGAAATACGCGGC
ATGCTGTGGTGCGTGCCGCACCCGCGCGAGTTCCTGTTCCGCACCGATATCGACCTGGAAAGCGGGCACA
TGGACCTGCGCGACCTGGGAGGGGCGTGA
 Primer design