SecReT6
Protein ID: 412339934
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2637
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2857525..2858334 [-]
Producthypothetical protein
NoteTagJ
UniProt IDK4QLN4
KEGG IDbbh:BN112_2637
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.90E-44, Aligned region: 147..264
Protein Sequence: 269 a.a.     [Download]
>gi|412339934|ref|YP_006968689.1| hypothetical protein BN112_2637 [Bordetella bronchiseptica 253]
MQTSVLAMPPRDGGLAGQAAAVQARIRRAPADADLRAQLFQLAAVQGDWRRAAEQLQLCARLNPLAQPMA
NLYLAAIYGEQRRVAVLAGQAEPGFLAERPCWCEPLLQALRAQASDPERAAMLRAQAFDAAQASAGTLED
AAAGQAGYAWICDGDSRLGPVCELILDGSYAWLPFAQVAAVHLPAPQGLCDLVWARAEIALADGAVVRGL
VPARYPPSAGQDDGLRLGRATCWRPLGQDGYAGEGQKMWLTDAGEFALLDVRALRRQAP
 
Nucleotide Sequence: 810 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2858334-2857525 Bordetella bronchiseptica 253, complete genome
ATGCAGACATCCGTGCTTGCGATGCCCCCGCGCGACGGCGGCCTGGCCGGCCAGGCCGCGGCCGTGCAGG
CGCGCATCCGGCGCGCGCCGGCCGACGCCGATTTGCGCGCGCAACTTTTCCAGCTGGCTGCCGTGCAGGG
CGACTGGCGCCGCGCCGCCGAGCAATTGCAACTGTGCGCCCGGCTGAACCCGCTGGCCCAGCCGATGGCC
AATCTCTACCTGGCGGCCATCTATGGCGAGCAGCGGCGCGTAGCGGTGCTGGCGGGCCAGGCCGAACCCG
GCTTCCTGGCCGAGCGGCCCTGCTGGTGCGAGCCGTTGCTGCAGGCGCTGCGCGCCCAGGCGAGCGACCC
CGAGCGGGCCGCCATGCTGCGCGCCCAGGCGTTCGATGCGGCGCAGGCCAGCGCCGGCACGCTGGAGGAC
GCGGCCGCCGGCCAGGCCGGCTATGCCTGGATCTGCGACGGCGACAGCCGCCTGGGGCCGGTCTGCGAAC
TGATTCTCGACGGCAGCTATGCGTGGCTGCCGTTCGCGCAGGTGGCCGCCGTGCATCTGCCGGCCCCGCA
AGGGCTGTGCGATCTCGTCTGGGCGCGCGCCGAAATCGCCCTGGCCGACGGCGCGGTCGTGCGCGGCCTG
GTTCCGGCGCGCTACCCGCCGTCGGCCGGGCAGGATGACGGCCTGAGGCTGGGCCGGGCCACGTGCTGGC
GGCCGCTGGGCCAGGACGGCTACGCCGGCGAGGGCCAGAAGATGTGGCTGACCGACGCGGGCGAGTTCGC
GCTGCTGGACGTGCGCGCCCTGCGCCGGCAGGCGCCATGA
 Primer design