SecReT6
Protein ID: 412339935
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2638
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2858384..2858851 [-]
Producthypothetical protein
NoteTssD
UniProt IDK4QN36
KEGG IDbbh:BN112_2638
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.40E-36, Aligned region: 1..129
Protein Sequence: 155 a.a.     [Download]
>gi|412339935|ref|YP_006968690.1| hypothetical protein BN112_2638 [Bordetella bronchiseptica 253]
MKIEGANGESKDANHKDWTDIVSFSWGATQPASLATGGGQGAGKASFNDLHVVARIDKAAPAVMKHCASG
KHLGKIELSVCKAGGAQVEYSKVTLEDVLVTSVQIAAENGSEAVLVNYAFQAAKVRQQYWEQTESGGKGA
ESLVAWDIKQNKEIG
 
Nucleotide Sequence: 468 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2858851-2858384 Bordetella bronchiseptica 253, complete genome
ATGAAGATCGAAGGCGCCAATGGCGAATCCAAGGACGCCAACCACAAGGACTGGACCGATATCGTGTCCT
TTTCGTGGGGCGCCACCCAGCCGGCCAGCCTGGCGACCGGCGGCGGCCAGGGCGCGGGCAAGGCCAGCTT
CAACGATCTGCACGTGGTGGCCCGCATCGACAAGGCGGCGCCGGCGGTCATGAAGCACTGCGCCAGCGGC
AAGCACCTGGGCAAGATCGAACTGTCGGTGTGCAAGGCGGGCGGCGCGCAGGTCGAGTACAGCAAGGTCA
CGCTGGAAGACGTGCTGGTCACCTCGGTGCAGATCGCCGCGGAAAACGGTTCGGAGGCGGTGCTGGTCAA
CTATGCCTTCCAGGCCGCCAAGGTGCGCCAGCAGTACTGGGAGCAGACCGAGTCGGGCGGCAAGGGCGCC
GAGAGCCTGGTCGCGTGGGACATCAAGCAGAACAAGGAAATCGGCTGA
 Primer design