SecReT6
Protein ID: 412339936
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2639
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2858927..2860429 [-]
Producthypothetical protein
NoteTssC
UniProt IDK4QM81
KEGG IDbbh:BN112_2639
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.20E-196, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|412339936|ref|YP_006968691.1| hypothetical protein BN112_2639 [Bordetella bronchiseptica 253]
MTAVARRERAQAESSLAADDLSALLKKEFKPKTEQAREAVEHAVRTLAHQALENSGLGLSSDAYRTIQAI
IAEIDRKLSEQINLVMHHPDFQQLEGAWRGLHYLVTNTETDELLKIRFMCLSKNELGRTLKRYKGVGWDQ
SPIFKRVYEEEYGQFGGEPIGCLVGDYSFDHSPPDVELLGEIARISAAAHCPFIAGASPNVMQMDSWQEL
SNPRDLTKIFTNTEYAAWRSLRESEDARYVGLAMPRFLARLPYGARTNPVDEFDFEEETDGANHDRYTWA
NSAYAMAANINRSFKLYGWCTSIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNSDFAAFIGAQSLQRPQEYHDADASANAKLAARLPYLFACCRFAHYLKCIVRDKIGSFRERSD
MERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVTEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVS
KLPSLKQNEG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2860429-2858927 Bordetella bronchiseptica 253, complete genome
ATGACCGCAGTGGCCCGGCGCGAACGCGCGCAAGCCGAATCCAGCCTGGCGGCGGACGACCTGTCCGCCC
TGCTGAAGAAAGAGTTCAAGCCCAAGACCGAGCAGGCGCGCGAGGCCGTGGAGCACGCGGTGCGCACGCT
GGCGCACCAGGCCCTGGAAAACAGCGGGCTGGGCCTGTCCTCGGACGCCTACCGGACCATCCAGGCCATC
ATCGCCGAGATCGACCGCAAGCTGTCCGAGCAGATCAACCTGGTGATGCACCATCCCGACTTCCAGCAGC
TCGAAGGCGCCTGGCGCGGACTGCACTACCTGGTCACCAACACCGAGACCGACGAGCTGCTGAAGATCCG
CTTCATGTGCCTGTCCAAGAACGAGCTGGGGCGTACGCTCAAGCGCTACAAGGGGGTCGGCTGGGACCAG
AGCCCGATCTTCAAGCGCGTCTACGAGGAAGAGTACGGCCAGTTCGGCGGCGAGCCCATCGGCTGCCTGG
TGGGCGACTACAGCTTCGACCACAGTCCGCCCGATGTCGAGCTGCTGGGCGAGATCGCCCGCATCAGCGC
CGCCGCCCACTGCCCCTTCATCGCCGGCGCCTCGCCCAACGTGATGCAGATGGATTCCTGGCAGGAGCTT
TCCAACCCGCGCGACCTGACCAAGATCTTCACCAATACCGAGTACGCCGCCTGGCGCAGCCTGCGCGAAT
CGGAAGACGCGCGCTATGTCGGCCTGGCCATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGCGCGCGCAC
CAATCCGGTCGATGAGTTCGATTTCGAGGAAGAAACCGACGGCGCCAACCACGACCGGTACACCTGGGCC
AATTCGGCCTACGCGATGGCCGCCAACATCAACCGTTCGTTCAAGCTGTACGGCTGGTGCACCTCGATCC
GCGGCGTGGAATCCGGCGGCGCGGTCGAGAACCTGCCATGCCACACCTTCCCGACCGACGACGGCGGAGT
GGACATGAAGTGTCCCACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAGCTGGCCAAGAACGGCTTC
ATGCCGCTGGTGCATCGCAAGAACTCCGATTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGCGTCCGC
AGGAATACCACGACGCCGACGCCAGCGCCAACGCCAAGCTGGCCGCGCGCCTGCCCTACCTGTTCGCCTG
CTGCCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTTCGCGAGCGCAGCGAC
ATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGACCCGGCCAACTCTTCGCAGGAAA
CCAAGGCGCGCAAGCCGCTGGCCGCCGCCGAGGTGCAGGTCACCGAGATCGAGGACAACCCGGGCTATTA
CGCCGCCAAGTTTTTCCTGCGGCCGCACTATCAGCTCGAGGGGCTGACGGTGTCGCTGCGGCTCGTGTCC
AAGCTGCCTTCGCTCAAGCAGAACGAAGGCTGA
 Primer design