SecReT6
Protein ID: 412339937
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2640
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2860451..2861014 [-]
Producthypothetical protein
NoteTssB
UniProt IDK4QF91
KEGG IDbbh:BN112_2640
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-57, Aligned region: 13..165
Protein Sequence: 187 a.a.     [Download]
>gi|412339937|ref|YP_006968692.1| hypothetical protein BN112_2640 [Bordetella bronchiseptica 253]
MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSNTPQPEVGERKFLDVDID
NFDERMKSVAPRAAFQVANTLTGAGHLNVDITFESIDDFSPATVARKVGALNEMLEARTQLANLLTYMDG
KTGAEELIGQVLQNPALLGALAAAPKPADAGPADADAESAQPGPQAR
 
Nucleotide Sequence: 564 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2861014-2860451 Bordetella bronchiseptica 253, complete genome
ATGGCAACCACGCTCAAAGGCAGCGGCCAGAAATTCATCGCCAGGAATCGCGCGCCGCGCGTGCAGATCG
AGTACGACGTGGAGATCTACGGCGCCGAGCGCAAGATCCAGCTGCCCTTCGTCATGGGCGTGCTGGCCGA
CCTGGCCGGCAAGTCGAACACGCCGCAGCCCGAAGTGGGCGAGCGCAAGTTCCTCGACGTAGATATCGAC
AATTTCGACGAGCGCATGAAGTCGGTCGCCCCGCGGGCCGCGTTCCAGGTGGCCAATACGCTGACCGGCG
CCGGCCATCTGAACGTGGACATCACCTTCGAGAGCATCGACGATTTTTCCCCGGCCACCGTGGCGCGCAA
GGTGGGCGCGCTCAACGAGATGCTGGAGGCCCGCACGCAGCTGGCCAACCTGCTGACCTACATGGACGGC
AAGACCGGCGCCGAGGAGCTGATCGGCCAGGTGCTGCAGAACCCGGCCCTGCTGGGCGCGCTGGCGGCCG
CGCCCAAGCCCGCCGACGCCGGGCCGGCCGATGCCGACGCCGAGAGCGCGCAGCCCGGCCCGCAAGCCCG
ATAA
 Primer design