SecReT6
Protein ID: 412339938
SecReT6 ID712
T6SS typei3
Gene symbol-
Locus tagBN112_2641
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2861057..2862106 [-]
Producthypothetical protein
NoteTssA
UniProt IDK4QM48
KEGG IDbbh:BN112_2641
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-23, Aligned region: 59..118
ImpA-rel_N [PF06812], Evalue: 1.20E-23, Aligned region: 228..244
Protein Sequence: 349 a.a.     [Download]
>gi|412339938|ref|YP_006968693.1| hypothetical protein BN112_2641 [Bordetella bronchiseptica 253]
MPRMTTNMEFADLLKTLTPSLPCGEDLEYDADFLQLQQAAVGRSEQQFGATIIPAQAPDWRAVERLALGL
LERTRDLRIIAYLTRAWTEMRGLPGYAEGVTLAAGTLEQYWDAVHPMLASGGEEDPMPRVNALASLGDPQ
GCVRGMRSACLLDDVHGRLSLRDAEALLDGGRSEADYPGGRTRLIENLRQARLRRDDAALAVGAAAGALR
RIQQQATQRLGSAWCPDYAQALRALDALLRTWSDLDETAAAPAAAMPAEAHHAAPAPEPQPAPASWHDAR
IATREDAMAMLAKVSAYFETHEPSHPAPYLIRRVQQLIPLDFHDILRNLAPQGLAQFEAWTAREAASQS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2862106-2861057 Bordetella bronchiseptica 253, complete genome
TTGCCGCGCATGACGACGAACATGGAATTTGCCGACCTGTTGAAGACGCTGACGCCCAGCCTGCCCTGCG
GGGAGGACCTGGAGTACGACGCTGATTTCCTGCAGTTGCAGCAGGCTGCCGTGGGCCGCAGCGAGCAGCA
GTTCGGCGCCACCATCATCCCCGCGCAGGCGCCCGACTGGCGCGCGGTGGAGCGGCTGGCGCTGGGGCTG
CTGGAGCGCACGCGCGACCTGCGCATCATCGCCTACCTGACGCGCGCCTGGACCGAGATGCGCGGCCTGC
CCGGCTATGCCGAGGGCGTGACGCTGGCCGCCGGCACGCTGGAGCAATACTGGGACGCGGTGCATCCGAT
GCTGGCCAGCGGCGGCGAGGAAGACCCGATGCCGCGCGTCAATGCGCTGGCCTCGCTGGGCGACCCGCAG
GGCTGCGTGCGCGGCATGCGCTCGGCCTGCCTGCTCGACGATGTGCATGGCCGCCTGTCGCTGCGCGATG
CCGAGGCCCTGCTCGACGGCGGCAGGAGCGAGGCCGACTATCCGGGCGGGCGCACGCGCCTGATCGAGAA
CCTGCGCCAGGCGCGCCTGCGGCGCGACGACGCGGCGCTGGCCGTGGGCGCGGCCGCCGGCGCGCTGCGC
CGCATCCAGCAGCAGGCCACCCAGCGCCTGGGCTCGGCCTGGTGTCCGGACTATGCGCAGGCGCTGCGCG
CGCTGGATGCCTTGCTGCGCACCTGGAGCGACCTGGACGAAACCGCGGCGGCGCCCGCCGCGGCCATGCC
GGCCGAAGCGCATCACGCGGCCCCGGCGCCTGAACCCCAACCCGCGCCCGCCAGCTGGCACGACGCGCGC
ATCGCCACGCGCGAAGACGCGATGGCCATGCTGGCCAAGGTCAGCGCCTACTTCGAAACCCATGAGCCCA
GCCATCCGGCGCCCTATCTGATCCGCCGGGTGCAGCAGCTCATTCCCCTGGATTTCCACGACATCCTGCG
CAACCTGGCCCCGCAGGGCCTGGCGCAGTTCGAGGCGTGGACCGCGCGCGAGGCCGCCAGCCAGTCCTAG
 Primer design