SecReT6
Protein ID: 412339944
SecReT6 ID712
T6SS typei3
Gene symbolvrgS
Locus tagBN112_2647
StrainBordetella bronchiseptica 253
Repliconchromosome [GenBank: NC_019382] [Browse all T6SS(s) in this replicon]
Location [Strand]2868385..2870748 [-]
Producthypothetical protein
NoteTssI
UniProt IDK4QLP0
KEGG IDbbh:BN112_2647
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-89, Aligned region: 31..335
Phage_GPD [PF05954], Evalue: 2.20E-89, Aligned region: 546..578
Phage_GPD [PF05954], Evalue: 2.20E-89, Aligned region: 649..663
Phage_base_V [PF04717], Evalue: 2.90E-25, Aligned region: 371..464
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 507..529
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 530..551
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 548..567
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 564..575
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 604..624
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 610..632
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 620..639
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 626..648
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 636..656
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 660..672
Gp5_C [PF06715], Evalue: 3.40E-13, Aligned region: 676..694
Protein Sequence: 787 a.a.     [Download]
>gi|412339944|ref|YP_006968699.1| hypothetical protein BN112_2647 [Bordetella bronchiseptica 253]
METILAMAERIVRALTPLPPQALQFRSMHGHEGLSALYEFEVDLLAATHTLELKSLLGKPVSLEIETGGA
PRYLSGQATRCALVGREGDSARQYVYRVTMRPWLWYLTQTSDSKIFQQMSVVDVLRQVLADYPFPVEYRL
AGSYRRWEYCVQYQETDFAFVSRLMEHEGIYYWFRHESGRHTLVLTDDITQHDECPGAAQLPYYGPDRAT
VPQEQYVSQWQVAEEITPDGFATVDYDFKKPAASLDAQSSNPGAYEPGGLQVYEWLGGYTEPDQGERYSR
IRLEALQAHGESVTGACNVRAFAPGYLFTLRNHPRPAENRQYLIAQAHYRIQEGGYASGAEDAVFDIDFR
VLPATVPFRVARATPVPRTHGPQTATVVGQAGEEIWTDEYGRVKVHFHWDRYGKKNENSSCWVRVSSPWA
GGGFGGIQLPRVGDEVIVDFIGGYPDRPIVIGRVYNASNMPPWDLPGNATQSGFLSRSKNGDRGTANALM
FEDSAGAERIWLHAERDMDCEVEANESHTVDGNRTTLIGGNDTLTVRGTRTTTIDGLDTETFNAGATRTV
TGEVSETTTGNETRTFNGDVTETVNGVETRTVNGDWKETITGEMTETRTGDETRTVTGAVTETIAGDVTQ
TITGAVTQTQTGAHDITITGDQTSSITGAVSHTVTGAYTQTVTDPVTVNANTSMTVVTPSWTVSSASQQA
FWTANTLRGTPARLTVVGAAADFWGVRQQVYGGINSQWSTVKIDLAAFKNGSNGFESGQAGAQIKAIGAQ
IKTGGAAVISRVINLFT
 
Nucleotide Sequence: 2364 bp     [Download]
>gi|412337338|ref|NC_019382.1|:c2870748-2868385 Bordetella bronchiseptica 253, complete genome
ATGGAGACGATCCTCGCAATGGCCGAACGCATCGTACGCGCCCTGACCCCGCTGCCCCCGCAAGCCCTGC
AGTTTCGCAGCATGCACGGCCACGAAGGCCTGTCGGCGCTGTACGAATTCGAGGTGGACCTGCTGGCGGC
CACCCATACGCTGGAACTGAAATCGCTGCTGGGCAAGCCGGTTTCGCTGGAAATCGAAACAGGCGGCGCG
CCGCGCTACCTGTCGGGCCAGGCGACCCGCTGCGCCCTGGTGGGGCGCGAAGGCGACAGCGCGCGCCAGT
ATGTGTACCGGGTGACCATGCGGCCCTGGCTGTGGTACCTGACGCAGACCTCGGACAGCAAGATCTTCCA
GCAGATGTCGGTGGTGGACGTGCTGCGCCAGGTGCTGGCCGACTACCCGTTTCCGGTCGAGTACCGGCTG
GCCGGCAGCTACCGCCGCTGGGAATACTGCGTGCAGTACCAGGAAACCGATTTCGCCTTCGTCAGCCGCC
TGATGGAGCACGAGGGCATCTACTACTGGTTCCGCCACGAGTCGGGCAGGCACACGCTGGTGCTGACCGA
CGACATCACCCAGCACGACGAGTGTCCGGGCGCGGCGCAGCTGCCGTATTACGGCCCGGATCGCGCCACG
GTGCCTCAGGAGCAATACGTATCGCAGTGGCAGGTGGCCGAGGAGATCACGCCCGATGGCTTCGCCACCG
TGGACTACGACTTCAAGAAGCCGGCCGCCAGCCTGGACGCGCAATCGAGCAACCCGGGCGCCTACGAGCC
GGGCGGGCTGCAGGTGTACGAGTGGCTGGGCGGCTATACCGAGCCGGACCAGGGCGAGCGCTATTCGCGC
ATCCGCCTGGAGGCCCTGCAGGCGCACGGCGAAAGCGTGACCGGCGCGTGCAACGTGCGCGCCTTCGCGC
CGGGTTACCTGTTCACGTTGCGCAACCATCCGCGCCCGGCCGAGAACCGCCAATACCTGATCGCGCAGGC
GCATTACCGCATCCAGGAAGGCGGCTACGCCAGCGGCGCCGAGGATGCCGTCTTCGATATCGACTTCCGC
GTCCTGCCGGCCACGGTGCCGTTTCGCGTGGCGCGCGCCACGCCGGTGCCGCGCACGCACGGGCCGCAGA
CCGCCACGGTGGTGGGCCAGGCCGGCGAAGAGATCTGGACCGACGAGTACGGCCGCGTCAAGGTGCACTT
CCACTGGGACCGCTACGGCAAGAAGAACGAGAACAGCTCGTGCTGGGTGCGCGTGTCCAGCCCCTGGGCG
GGCGGCGGCTTCGGCGGCATCCAGCTGCCGCGCGTGGGCGACGAAGTGATCGTGGACTTCATCGGCGGCT
ATCCCGACCGGCCCATTGTCATCGGCCGCGTCTACAACGCCAGCAACATGCCGCCCTGGGACCTGCCCGG
CAACGCCACGCAAAGCGGGTTTCTCAGCCGCTCCAAGAACGGCGACCGGGGCACCGCCAACGCGCTGATG
TTCGAGGACAGCGCGGGCGCCGAACGCATCTGGCTGCACGCCGAGCGCGACATGGACTGCGAGGTCGAGG
CCAACGAGTCGCACACGGTCGACGGCAACCGCACCACCCTGATCGGCGGCAACGATACGCTGACGGTGCG
GGGCACGCGCACCACCACCATTGACGGGCTGGACACCGAAACCTTCAACGCCGGCGCCACGCGCACCGTC
ACCGGCGAGGTGTCGGAGACCACCACCGGCAACGAGACGCGCACCTTCAACGGCGACGTGACCGAAACCG
TCAACGGCGTGGAGACGCGCACGGTCAACGGCGACTGGAAGGAAACCATCACCGGCGAGATGACCGAAAC
GCGCACGGGCGACGAAACCCGCACGGTGACCGGCGCCGTCACGGAGACCATTGCCGGCGACGTGACGCAG
ACCATCACCGGCGCGGTCACGCAAACACAGACCGGCGCGCACGACATCACCATCACCGGCGACCAGACCT
CCAGCATCACCGGCGCGGTGTCGCACACGGTCACCGGCGCGTATACCCAGACGGTCACCGATCCGGTCAC
GGTCAACGCCAACACCAGCATGACCGTGGTCACGCCGTCGTGGACCGTCTCGTCGGCGTCGCAGCAGGCG
TTCTGGACCGCCAACACCTTGCGCGGCACGCCGGCGCGCCTGACGGTGGTCGGCGCCGCGGCCGACTTCT
GGGGCGTGCGCCAGCAGGTCTACGGCGGCATCAACTCGCAGTGGTCCACCGTGAAGATCGACCTGGCCGC
GTTCAAGAACGGCTCCAACGGCTTCGAGAGCGGCCAGGCCGGCGCGCAGATCAAGGCCATCGGCGCGCAG
ATCAAGACCGGCGGGGCGGCGGTGATCTCGCGCGTCATCAATCTCTTCACCTAG
 Primer design