SecReT6
Protein ID: 426409978
SecReT6 ID713
T6SS typei2
Gene symboltssM
Locus tagPputUW4_03077
StrainPseudomonas sp. UW4
Repliconchromosome [GenBank: NC_019670] [Browse all T6SS(s) in this replicon]
Location [Strand]3612897..3616277 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDK9NKW9
KEGG IDppuu:PputUW4_03077
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.70E-75, Aligned region: 410..726
DUF1215 [PF06744], Evalue: 1.20E-33, Aligned region: 256..301
DUF1215 [PF06744], Evalue: 1.20E-33, Aligned region: 537..549
DUF1215 [PF06744], Evalue: 1.20E-33, Aligned region: 847..967
Protein Sequence: 1126 a.a.     [Download]
>gi|426409978|ref|YP_007030077.1| ImcF domain-containing protein [Pseudomonas sp. UW4]
MQFRRSVGIGVLVSVLVVAGLVLAAQVWYHPESLGIESGSGWQTLWFSVVSATTLIVAMFLGGYPLLGRL
LGHSTYGRLDTDDVHQPAQVFPEKNVDTPGARTIAAIKASLRKRHGHLWRHKTRLLLIVGEPEQIQAIAP
GLSNDNWLEDHNTLLFWGGSVQTQLDDSVLDRCRALTRWSALDGVVWALNAEQSADDNLMGNGARHLQDL
ARTLGWSLPLHLWQVCASSWAQDQRPTQAVGCALPSRLTPPILEHALENLLEPLRHEGWAQMSTRPDHDF
LLRLSRDLQVEGLARWRQALAPWFGGFRQDLPLRGLWFSLPLTGKTLRKDDHFWSMGPVWQGVLDAPKPH
SRRLGWSAPRVAYGLALGLAVVWGTGLLLSFATNRVQIAQVQTVLITLEQSQSADDQFLAFNELVRELAR
LDYRAEHGTPWYQRFGLNQNDALLAELWPRYVEANQRLLRDPAVAHLQARLNALVKLPPDSPERSKRAGV
AYAQLKAYLMLARPEKSDPAFLAQALSDAEPQRAGFSPGLWQGLSPTLWQFYAQQLARHPQWRIEADPRL
VAQARQVLLGQLGQRNGETSLYQSVLDSAANHAPALNLQQMVGDTEATALFSTSAEVPGVFTRQAWEGQV
RPAIAAIAEARREEIDWVLSDNPASLAVELTPDQLKERLTERYFQDYANAWLDFLNHLRWQPVDSLGEVI
DQLALMSDVRQSPLIALMNTLAWQGQAGTRGQALGESLIKSAQKLIAQDSVPPIEQSLDGPGGPLDATFG
PLLSLLGKDVERTNDSERLSLQAFLNRVTRVRLKLQQVSNAPNPQAMTQALAQSVFQGHSVDLTDTQAYG
NLLAASLGAEWDGIGQTLFVQPLEQAWQRVLQPSTAGLNSQWQRAIVKDWHGAFVGRYPFAATASDASLP
MLGQMIRADSGRIEQFLQQQLGGVLRKEGSRWVADARHSQGLHFNPKFLTAINQLSHLADVLYTDGGMGL
SFELRGKPVRDVVQTTFILNGEKHEYFNQKERWQRFSWPGFSQHPGTRLLWISVLANERLFGDYEGTWGL
IRLLEQAKVTALNDTDSQYRVQLRAPDGLDLTWHLRTELGAGPLALLKLRGFELPAQIFLGEGTQAQPYA
QNGSYP
 
Nucleotide Sequence: 3381 bp     [Download]
>gi|426406915|ref|NC_019670.1|:c3616277-3612897 Pseudomonas sp. UW4 chromosome, complete genome
ATGCAGTTTCGACGCTCTGTAGGGATAGGTGTTTTGGTCAGCGTGCTGGTGGTCGCTGGTCTGGTGTTGG
CTGCACAGGTTTGGTATCACCCTGAGTCGCTAGGTATTGAATCCGGCAGCGGCTGGCAAACCCTCTGGTT
TTCGGTGGTCTCGGCCACCACCTTGATCGTGGCGATGTTCCTGGGTGGTTATCCATTGCTGGGACGGCTG
TTGGGGCATTCAACTTATGGCCGGCTTGATACGGATGACGTTCACCAGCCTGCGCAAGTGTTCCCGGAAA
AAAACGTTGATACGCCGGGAGCACGAACCATCGCGGCGATCAAAGCTTCCTTGCGCAAGCGCCACGGCCA
CCTCTGGCGCCACAAAACACGCCTCCTGCTCATCGTCGGCGAACCCGAGCAGATCCAGGCCATCGCCCCC
GGCCTGAGCAACGACAACTGGCTGGAAGACCACAACACCCTGTTGTTCTGGGGCGGCAGTGTGCAAACCC
AACTGGACGATTCCGTGCTCGACCGCTGTCGCGCCTTGACCCGCTGGAGCGCCCTCGACGGCGTGGTCTG
GGCGCTGAACGCCGAGCAGAGCGCCGACGACAACCTGATGGGCAACGGTGCACGTCACCTGCAAGATCTG
GCGCGTACGCTGGGCTGGTCGTTGCCGTTGCACCTGTGGCAGGTCTGCGCCAGTTCGTGGGCGCAGGACC
AGCGCCCAACCCAGGCGGTCGGCTGCGCGCTGCCGTCACGCCTGACGCCGCCGATCCTGGAACACGCGCT
GGAAAATTTGCTGGAACCGTTGCGCCACGAAGGCTGGGCGCAGATGAGCACGCGGCCCGATCATGATTTC
CTGCTGCGCTTGTCGCGGGACTTGCAGGTCGAAGGCCTGGCCCGTTGGCGTCAGGCGCTTGCGCCGTGGT
TCGGGGGCTTCCGGCAGGACCTGCCGTTGCGCGGGTTGTGGTTCAGCTTGCCGCTGACCGGTAAAACGTT
GCGCAAAGATGATCACTTCTGGTCCATGGGGCCGGTCTGGCAGGGCGTGCTGGACGCCCCGAAACCGCAC
AGCCGGCGCTTGGGTTGGAGCGCGCCGCGCGTCGCTTATGGGCTGGCGTTGGGTCTGGCCGTGGTCTGGG
GCACCGGACTGCTGCTGTCGTTCGCCACCAACCGCGTGCAGATCGCGCAGGTGCAGACCGTGTTGATCAC
CCTCGAACAATCGCAAAGCGCCGATGACCAATTCCTCGCGTTCAACGAACTGGTCCGCGAACTGGCTCGT
CTGGATTACCGCGCCGAACACGGCACGCCGTGGTATCAGCGCTTTGGCCTCAATCAAAACGATGCGCTGC
TGGCCGAGCTGTGGCCGCGTTACGTCGAGGCCAATCAGCGCTTGCTGCGCGATCCGGCGGTGGCCCACTT
GCAGGCGCGGCTCAACGCGCTGGTCAAACTGCCGCCGGACAGCCCCGAACGCAGCAAGCGTGCCGGTGTG
GCCTACGCGCAACTCAAGGCCTACCTGATGCTGGCGCGCCCGGAAAAATCCGATCCGGCGTTCCTGGCCC
AGGCCCTGAGCGACGCCGAGCCGCAGCGCGCCGGGTTCTCGCCGGGACTCTGGCAGGGCCTGTCGCCGAC
CCTGTGGCAGTTCTACGCGCAGCAACTGGCGCGCCATCCGCAATGGCGCATCGAAGCCGACCCACGACTG
GTGGCCCAGGCCCGCCAAGTACTGCTCGGCCAGTTGGGCCAGCGCAATGGCGAAACCAGCCTGTACCAGA
GCGTCCTCGACAGCGCGGCCAATCACGCGCCGGCGTTGAATCTGCAGCAGATGGTCGGCGACACCGAGGC
GACGGCGCTGTTCTCCACATCGGCCGAAGTGCCCGGCGTGTTCACCCGCCAGGCCTGGGAAGGCCAGGTG
CGGCCGGCCATCGCCGCCATCGCCGAGGCCCGGCGCGAAGAAATCGACTGGGTGCTCAGCGACAATCCCG
CCAGCCTCGCCGTCGAACTGACCCCGGACCAGCTCAAGGAGCGACTGACCGAGCGCTACTTTCAGGACTA
CGCCAACGCCTGGCTGGACTTCCTCAACCACCTGCGCTGGCAACCGGTCGACAGCCTGGGCGAGGTGATT
GATCAACTGGCGCTGATGAGCGACGTGCGCCAGTCGCCGCTGATCGCGCTGATGAACACCTTGGCCTGGC
AGGGGCAGGCCGGCACGCGCGGCCAGGCCTTGGGCGAGTCGTTGATCAAGTCGGCGCAGAAGCTGATCGC
CCAGGACAGCGTGCCGCCGATCGAGCAGTCGCTCGACGGGCCGGGTGGTCCGCTGGACGCCACCTTCGGG
CCATTGCTGAGCCTGCTGGGCAAGGACGTCGAGCGCACCAACGACAGCGAGCGCCTGAGCCTGCAAGCCT
TCCTCAACCGCGTCACCCGGGTGCGACTGAAGCTGCAACAAGTGAGCAACGCGCCGAACCCGCAGGCTAT
GACTCAAGCCCTGGCGCAGAGCGTGTTCCAGGGTCACAGCGTCGACCTCACCGACACCCAGGCCTACGGC
AACCTGCTCGCCGCCAGCCTCGGCGCCGAGTGGGACGGGATCGGCCAGACCCTGTTCGTGCAGCCGCTGG
AGCAGGCCTGGCAACGGGTGCTGCAACCCTCGACGGCGGGCCTCAACAGCCAGTGGCAGCGGGCGATCGT
CAAGGACTGGCACGGCGCCTTCGTCGGTCGCTACCCCTTCGCGGCCACCGCCAGCGACGCCTCGCTGCCG
ATGCTCGGGCAAATGATCCGCGCCGACTCCGGGCGCATTGAACAGTTTCTGCAACAGCAACTGGGCGGTG
TGCTGCGCAAGGAAGGCAGCCGCTGGGTGGCCGACGCGCGGCACAGCCAGGGTCTGCACTTCAACCCGAA
GTTCCTGACGGCGATCAACCAGCTCAGCCACCTCGCCGACGTGCTCTACACCGACGGCGGCATGGGCCTG
AGTTTCGAGCTGCGCGGCAAGCCGGTGCGCGACGTGGTGCAGACCACTTTCATCCTCAACGGCGAAAAGC
ATGAGTACTTCAACCAGAAGGAACGCTGGCAGCGCTTCAGCTGGCCGGGCTTCAGCCAGCATCCGGGCAC
GCGTTTGTTGTGGATCAGTGTGCTGGCCAATGAACGGCTGTTCGGCGACTACGAAGGCACCTGGGGCCTG
ATCCGCCTGCTGGAACAAGCGAAAGTCACCGCGCTGAACGACACCGACAGCCAGTATCGCGTGCAGCTCA
GGGCACCTGATGGCCTCGACCTGACCTGGCACCTGCGCACCGAACTGGGCGCAGGGCCGCTGGCGCTGCT
CAAGTTGCGCGGCTTTGAATTGCCGGCGCAGATTTTTCTCGGCGAGGGCACTCAAGCGCAGCCTTATGCG
CAGAACGGAAGTTACCCATGA
 Primer design