SecReT6
Protein ID: 430743292
SecReT6 ID714
T6SS typei4a
Gene symbol-
Locus tagSinac_2415
StrainSingulisphaera acidiphila DSM 18658
Repliconchromosome [GenBank: NC_019892] [Browse all T6SS(s) in this replicon]
Location [Strand]2977926..2979344 [-]
Producthypothetical protein
NoteTssM
UniProt IDL0DDH5
KEGG IDsaci:Sinac_2415
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-18, Aligned region: 199..395
Protein Sequence: 472 a.a.     [Download]
>gi|430743292|ref|YP_007202421.1| hypothetical protein Sinac_2415 [Singulisphaera acidiphila DSM 18658]
MSYYFSGFGQWLAMTIGVGITAVGAYFLARWSWRWFVILCITVAAVVFLFLLPIRNPAHAFLDESTPPLF
LNYFWTWIFVLLVGFTLSLIAFGRALYQGRSPAVQESTAGGEGDRSSEIDSAWREIQLRLSNARIEAGAQ
HVYLVLVPDEGWTSALVHSAGLQLFAEGPDGEAPVHAYATADGIFLSVAGASTFGVQSEEGSRSLENVCR
RLLAERPNCPVVRGVVVLFPITWAGQPESVKWASSVREDLRTIERVLKVRCPVFAVFSEMETTPGFPEFV
GRMSTALRQSRCGFAVPASHPFSGDLVQNGLIWMSGWYHGWILSLMADDLFNVPGNNQLFSLDIEFRRYR
KRLRSVLEAAFSTHRETEPMLFRGCYFTATGAHPREQAFTAGLLRGPRGRILAEHPVTQWTQQAKDDDRF
YRKLALAVGLVGGGLSLLTWLAIITMTGHSIWWAGPIIMVIVWLIVLFRVVR
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|430741030|ref|NC_019892.1|:c2979344-2977926 Singulisphaera acidiphila DSM 18658 chromosome, complete genome
GTGAGCTATTATTTCAGCGGATTCGGGCAGTGGTTGGCGATGACCATCGGGGTCGGGATCACGGCGGTCG
GCGCTTACTTTTTGGCGCGTTGGTCGTGGCGATGGTTTGTCATTCTCTGTATCACGGTGGCGGCGGTCGT
TTTCCTTTTCCTGCTCCCCATTCGCAATCCGGCGCACGCGTTTCTTGATGAATCAACTCCCCCACTCTTC
CTCAACTATTTCTGGACCTGGATCTTCGTTCTGCTCGTAGGGTTCACCCTCTCGTTGATTGCGTTCGGCC
GGGCCCTCTACCAAGGGCGGTCGCCTGCCGTCCAGGAGAGCACGGCCGGGGGAGAGGGCGACCGATCCTC
CGAGATCGATTCCGCCTGGCGCGAAATCCAACTCCGGCTGAGCAATGCGCGGATCGAGGCCGGTGCGCAG
CATGTCTACCTCGTCCTGGTTCCCGATGAAGGGTGGACCTCGGCGTTGGTCCATTCGGCCGGTCTTCAAC
TCTTCGCCGAGGGACCCGACGGCGAAGCGCCCGTGCATGCGTACGCGACGGCCGACGGCATCTTCCTGAG
CGTGGCGGGTGCCTCTACCTTTGGAGTTCAAAGCGAGGAGGGGAGCCGCAGCCTCGAGAATGTCTGCCGC
CGGTTGCTGGCTGAACGCCCGAACTGCCCGGTCGTGCGGGGTGTGGTCGTTCTCTTCCCAATCACCTGGG
CGGGGCAGCCGGAATCGGTGAAATGGGCCTCCTCGGTGCGTGAAGACCTGCGGACGATCGAGCGTGTGCT
CAAGGTCCGCTGCCCTGTGTTTGCGGTCTTCTCCGAGATGGAAACAACTCCTGGTTTTCCGGAGTTTGTA
GGACGGATGTCGACTGCGCTCCGGCAGAGCCGCTGTGGGTTCGCCGTTCCCGCCTCGCACCCGTTCAGCG
GAGACCTGGTTCAAAACGGCCTCATCTGGATGTCAGGATGGTATCATGGCTGGATCTTGAGCCTGATGGC
CGATGACCTGTTCAACGTGCCGGGAAACAACCAGCTTTTCAGCCTCGATATCGAGTTCCGCCGCTATCGC
AAGCGACTTCGATCCGTCCTGGAGGCCGCGTTCTCGACCCATCGGGAAACCGAGCCGATGTTGTTCCGGG
GCTGTTACTTCACGGCGACCGGGGCGCACCCTCGCGAGCAAGCCTTCACCGCCGGACTCTTGCGCGGTCC
GCGCGGCCGGATCCTTGCCGAGCATCCGGTGACCCAGTGGACGCAACAGGCCAAGGACGACGACCGATTT
TATCGGAAGCTCGCCTTGGCCGTGGGACTTGTGGGAGGCGGTCTTTCCCTGCTGACCTGGTTGGCCATCA
TTACGATGACGGGCCACTCGATCTGGTGGGCGGGCCCTATCATCATGGTCATCGTTTGGTTGATCGTACT
TTTCCGCGTCGTCCGATAG
 Primer design