SecReT6
Protein ID: 431802747
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14065
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3090329..3092182 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL0FK94
KEGG IDppuh:B479_14065
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-80, Aligned region: 38..347
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 381..474
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 525..546
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 556..564
DUF2345 [PF10106], Evalue: 0.0074, Aligned region: 565..596
Protein Sequence: 617 a.a.     [Download]
>gi|431802747|ref|YP_007229650.1| Rhs element Vgr protein [Pseudomonas putida HB3267]
MIMDLASALLSPQNRRLFKFHNLANPEQELLLETFKGTEALSRAFNYELLLVCEDSGVPLKSMMGQHVSI
EIELAEGGPRYITGYLTRFASIGSDGGMARYTATLNPWFSMLKNRFDTRIFQGNTVEEVVTEVFALCPAF
SRHEFRLTRPQKRYTYITQYRETDFNFVQRLLEEEGMFYYFEHTAEGHTMIICDDSSTLVDIPEQPQIRF
HSASVTETADSITQWSGNRQLQSGKMATQTFDYRQPNNRLPVALNSVNKQGDVENFEIYDFPGQYTHGTY
DEGETLLRLRIEALELRGKKFEGASNCRAMKPGYTFELLQHYIHDQGPVEDRQFLLMSVESEGHNNYLTG
QQASYFNTFSCVRKKIPFRPQLSTPKPTIAGPQTAIIVGPPGEEIFTDELGRVKIQFHWDRNGKYNDHSS
CWVRVAQSGASGGFGSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKTQSGFLTRSMK
GDGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRTITVGGTHTEIIKKDTVVNVKEGAYT
LQVDNKFIQVSAKESILLQVGTSKITLKPDGITIEADSIDILGKNTFVKGDRVDINE
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|431799958|ref|NC_019905.1|:c3092182-3090329 Pseudomonas putida HB3267, complete genome
ATGATCATGGACCTGGCCTCCGCGCTGCTGTCGCCGCAGAACCGCCGCCTGTTCAAGTTTCACAACCTGG
CCAACCCCGAGCAGGAACTGCTGCTGGAAACCTTCAAGGGCACCGAAGCCCTGTCGCGGGCGTTCAACTA
CGAACTGCTGCTGGTCTGCGAAGACTCCGGCGTGCCGCTCAAATCCATGATGGGCCAGCATGTCAGCATC
GAGATCGAACTGGCCGAAGGCGGCCCGCGCTACATAACCGGCTACCTCACACGCTTTGCCAGCATTGGTA
GCGACGGCGGCATGGCGCGTTATACCGCAACCCTCAACCCGTGGTTCTCGATGCTGAAGAACCGCTTCGA
CACGCGGATCTTCCAGGGCAACACGGTCGAGGAAGTGGTTACCGAAGTGTTCGCCCTGTGCCCGGCGTTC
TCTCGTCACGAGTTCCGCCTGACCCGTCCGCAGAAGCGCTACACCTACATCACCCAGTACCGTGAAACCG
ACTTCAACTTCGTCCAGCGCCTGCTGGAGGAAGAGGGGATGTTCTACTACTTCGAGCACACCGCCGAAGG
CCACACCATGATCATCTGCGATGACTCCAGCACGCTGGTGGACATCCCCGAGCAACCGCAAATCCGCTTC
CACAGCGCCTCGGTCACCGAGACTGCCGACTCCATCACCCAGTGGAGCGGCAACCGCCAGTTGCAGTCCG
GCAAGATGGCCACGCAGACCTTCGACTACCGCCAGCCCAACAACCGCCTGCCGGTGGCGCTGAACAGCGT
GAACAAGCAGGGCGATGTCGAGAACTTCGAGATCTACGACTTCCCCGGCCAGTACACCCACGGCACCTAC
GACGAGGGCGAAACCCTGCTGCGCCTGCGCATCGAGGCGCTGGAGCTGCGCGGCAAGAAGTTCGAAGGTG
CCAGTAACTGTCGGGCCATGAAGCCGGGCTACACCTTCGAGCTGCTGCAGCACTACATCCACGACCAGGG
CCCGGTAGAAGACCGCCAGTTCCTGCTGATGAGCGTGGAAAGCGAAGGCCACAACAACTACCTTACCGGC
CAGCAGGCCAGCTACTTCAACACCTTCAGTTGCGTGCGCAAGAAGATCCCGTTCCGCCCGCAGCTGAGCA
CGCCCAAGCCGACCATCGCCGGCCCGCAGACCGCGATCATCGTCGGCCCACCGGGTGAGGAGATCTTCAC
CGACGAACTGGGCCGGGTGAAGATCCAGTTCCACTGGGACCGTAATGGCAAGTACAACGACCACAGCTCG
TGCTGGGTACGCGTCGCCCAGTCCGGTGCCAGCGGTGGCTTCGGCAGCATCCAGATCCCACGTGTAGGCG
ACGAAGTGGTGGTGGTGTTCCTCGACGGCAACCCCGACCGCCCGCTGATCATGGGCAGCCTGTACAACAG
CACCAACACCCCGCCATGGTCGCTGCCGGCAAACAAGACCCAGAGTGGCTTCCTGACCCGGTCGATGAAG
GGCGACGGCGGTACCGCCAACTTCTTCCGCTTCGAGGACAAGGCCGGCGCCGAGCAGATCATCATGCATG
CCGAGCGCAACATGGATACCGAGATCGAGCTGGATGAGACCCATGATGTGGGGAACAACCGGACGATTAC
AGTAGGTGGCACGCACACGGAAATTATCAAGAAAGATACGGTGGTGAACGTCAAGGAGGGGGCTTACACC
TTGCAGGTGGATAACAAGTTCATCCAGGTGAGCGCCAAAGAGAGCATCCTGCTGCAAGTCGGCACTAGCA
AGATAACCCTCAAACCGGATGGCATCACTATCGAAGCAGACAGCATCGACATTCTGGGCAAGAACACCTT
TGTCAAAGGTGACCGGGTCGACATCAACGAGTAG
 Primer design