SecReT6
Protein ID: 431802752
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14090
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3095659..3096234 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDL0FK98
KEGG IDppuh:B479_14090
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-60, Aligned region: 2..25
DUF770 [PF05591], Evalue: 2.20E-60, Aligned region: 23..177
Protein Sequence: 191 a.a.     [Download]
>gi|431802752|ref|YP_007229655.1| type VI secretion protein [Pseudomonas putida HB3267]
MIRSELLALENTMAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLK
DRKFVFIDRDNFNGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRN
KLADLRNKMGGNDKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSSDRA
 
Nucleotide Sequence: 576 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3095659-3096234 Pseudomonas putida HB3267, complete genome
ATGATTCGCAGCGAATTGCTCGCACTGGAGAACACGATGGCGAAGAAGGAAAGCACTCAGCACAAACTCG
ACCGCGTTCGCGCGCCTCGGGTCCATATCACCTACGACGTGGACATCGGCGATGCCATCGAGAAAAAGGA
GCTGCCCTTCGTCGTCGGCGTACTGGGCGACTTCTCCGGCAACCCGCTGGAGCCCCTGCCCAAGCTCAAG
GACCGCAAGTTCGTGTTCATCGACCGCGACAACTTCAACGGCGTGCTCAAGGGCATCAAGCCACGCCTGA
CCTACCGCGTCGACAACACCCTGGCCAAGAACGGCACCCAGCTGGGCGTGGAGCTGAACTTCAACAGCCT
CGAAGACTTCGAGCCACAGAACGTGGTCAAGCAGGTGGAGCCGCTGCGCAAGCTGCTGGAAGTGCGCAAC
AAGCTGGCCGACCTGCGCAACAAGATGGGCGGCAACGACAAGCTCGAAGAGCTGCTGATGGACGTGCTGC
AGAACACCGAGAAGCTCAAGACCCTGGGCAAGGAATTCGGCCGTGAAGCCGAAGTGAAAGACCCATCCAG
CAGCGATCGCGCCTGA
 Primer design