SecReT6
Protein ID: 431802753
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14095
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3096249..3097751 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDL0FL27
KEGG IDppuh:B479_14095
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-197, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|431802753|ref|YP_007229656.1| EvpB family type VI secretion protein [Pseudomonas putida HB3267]
MTDKQTAPQQAGDLVEVENFAPQASLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDSMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASPELFGWDSF
TEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3096249-3097751 Pseudomonas putida HB3267, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCGCCACAGG
CATCGTTGCTCGACAGCATCATTTCGCAAAGCCGCGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATTGGCGAACTGGTGAACCAGGTGCTCGAGGGCGAGATGACCCCGAGCAAGGACCTGATCGCC
GTGCTCGATTCGCGTATCGCCGAGATCGATTCGATGCTTTCCGAGCAGATGAACGAAATCATGCACGCCC
GTGAGTTCCAACAGCTGGAAGCCTCCTGGCGCGGCCTGAAATACCAGGTAGACCAGACCGAGACCAGCAC
CACGCTGAAGATCCACCTGCTCAATGCCTCGAAGAAAGACCTGGTACGCGACCTGAAGGCCGCCAGCGAA
TTCGACCAGAGCGCGCTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGCGGCGCGCCTTTCG
GCATGCTGATCGGTGATTACGAGTTCAACCGCAACCCCGAAGACATGTACCTGCTGGAGGAGATCTCGCA
CGTCGCCGCAGCAGCCCATGCCCCGTTCATTTCGGCCGCCTCCCCCGAGCTGTTCGGCTGGGACTCGTTC
ACCGAGATGTCCGGCCCGCGTGACCTGGCGAAGATCTTCGACACCGTGGAATACGCCAAGTGGAAGTCGT
TCCGCGCTTCGGAAGACTCGCGCTACGTCGGCCTTACCCTGCCGCACGTGCTCGGTCGCCTGCCGTATGG
CCCGGACACCACCCCGGTGGAGGAATTCAACTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAGTAC
CTGTGGATGAACGCTGCCTATGCCCTCGGCACCCGCGTTACCGATGCCTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGCGTGGAAGGTGGCGGCCTGGTCGAAGGTTTGCCAACCCACACCTTCAAGACCGACGA
CGGCGAAATCGCCCTCAAGTGCCCGACCGAAATCGCCATCACCGACCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATTCCCCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAGCAGAAGCAGTACAACACCGACATCGCCAACGCCAACGCGCGCCTGTCGGCCCAACTGCAGTACAT
CTTCGCCACTTCGCGCATCGCCCACTACATGAAGGCCATCATGCGCGACAAGATCGGTAGCTTCGCCTCG
CGCATGGATGTGGAGCGCTTCCTCAACCAGTGGCTGGCCAGCTACGTGCTGCTCGACGACACCGCCAGCC
AGGAAGCCAAGGCCAAGTTCCCGCTGCGCGAAGCCCGCGCCGAGGTGTTCGAAGTGCCGGGCAAGCCAGG
TGTGTACAAGGCCGTGACCTACCTGCGCCCGCACTACCAGCTGGATGAGCTGACCGCTTCGCTGCGCCTG
GTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA
 Primer design