SecReT6
Protein ID: 431802754
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14100
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3097778..3098260 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDL0FIC9
KEGG IDppuh:B479_14100
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|431802754|ref|YP_007229657.1| type VI secretion system lysozyme-like protein [Pseudomonas putida HB3267]
MSNQARLLPSLLDRLLDDRPYQSAEPAVQRTCSLSEYKASIVRDLEVLVNTRQSLVAEELEGYSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3097778-3098260 Pseudomonas putida HB3267, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCGTACCAGTCGG
CCGAGCCAGCCGTGCAACGCACCTGCTCGTTGAGCGAGTACAAGGCCAGCATCGTCCGTGACCTGGAGGT
ACTGGTGAACACTCGCCAGAGCCTGGTCGCCGAAGAGCTGGAGGGCTACAGCCAGCTCGGTGGCTCCATC
CTCGAATACGGCATGCCCGACTTCATCAGCCGCAGCGTGCTCGACCCGCATGATCGGCGCCTGATCCAGC
AGCAACTGGAGCGGGCGATCAGCACAGGGGACCGGCGCTTTCGCCGTGTCCGCGTGCAGCTGCTGGCCCA
GCAGAACGGCCACCGCATGTTGACCTTCCGCGTGGACGCCGTGTTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA
 Primer design