SecReT6
Protein ID: 431802755
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14105
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3098260..3100080 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDL0FM23
KEGG IDppuh:B479_14105
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-211, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|431802755|ref|YP_007229658.1| type VI secretion protein [Pseudomonas putida HB3267]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIAELSLGKHEKVTEAYRVARHTEMHANAVEGVVCKFRTCYPVELWPIAV
QQASFAELERSAFNGHSADLVARLRIRLAATGDALFGQMELDRLRFFLDGEATLMLQLYELLFNNLAKAT
LSFQDQGRSREVALPADALKAVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLNGFARILQGKA
IEQVEINFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAA
EVVSIDRVRRVRKLGGIDQVATCHPFFEPRGEQDPHSSFWVARRRIQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLMLPFGGERGDFNIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHMSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDESQFIGSGVY
LFGMVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3098260-3100080 Pseudomonas putida HB3267, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTCCTCGGCCAGGAGTTTG
CCGCGCAGTACCCGAAAATCGCTTCGCGGCTGTTGATCGAGGGTGACAACTGCGAAGACCCGCACACCGA
GCGCCTGATCGAAGCGTTCTCGTTCCTGTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTTGAGGTGCTGTACCCACACTACCTGCGCCCTACCCCATCGATGTCGATTGCCG
AGCTGAGCCTGGGCAAGCACGAGAAAGTCACCGAAGCCTACCGGGTGGCGCGCCATACCGAGATGCATGC
CAATGCCGTGGAAGGTGTGGTGTGCAAGTTCCGCACCTGCTACCCGGTAGAGCTGTGGCCGATTGCCGTG
CAGCAGGCCTCGTTCGCCGAACTGGAGCGTTCGGCCTTCAACGGCCACAGCGCCGACCTGGTCGCACGCC
TGCGCATCCGCCTGGCAGCCACCGGCGATGCCCTGTTCGGGCAGATGGAACTGGACCGCCTGCGGTTCTT
CCTCGACGGCGAGGCGACCCTGATGCTGCAGCTGTACGAGCTGCTGTTCAACAACCTGGCCAAGGCCACC
CTGAGCTTCCAGGACCAGGGCCGCAGCCGCGAAGTGGCCTTGCCGGCCGATGCCCTGAAAGCCGTGGGCT
ACGCCCGTGACGAAGGCCTGGTGGACTACTCCGAGCGCTCGTTCCTGGGCTACCGCCTGCTGCACGAGTA
CTTCACCTTCCCCGACAAGTTCATGTTCTTCGACCTGAACGGCTTTGCCCGCATTCTTCAGGGCAAGGCC
ATCGAGCAGGTCGAGATCAACTTCTATTTTTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACCC
AGAACATCGGGCGCAACAACTTCAAGCTCAACTGCACACCGATCATCAACCTGTTCCGCCAGCAAGCCGA
GCCGATCAAGCTGACCCACACCCAGCACGAATACCCGGTCACTCCCGATACACGGCTGCACAACGCTGCC
GAAGTCGTCTCGATCGACCGCGTACGGCGGGTGCGCAAACTCGGCGGCATCGACCAGGTCGCCACCTGCC
ACCCGTTTTTCGAACCCCGTGGCGAGCAGGACCCGCACAGCAGCTTCTGGGTGGCGCGCCGGCGCATCCA
GGGTGACGCCACCGCCATGAGCATCCGCGTGGTCGACCGCGACCTGGAGCTGATCGACGCCAGCAGCGAC
ACCCTCAGCATCGGCCTTACCTGCAGCAACCGCGATGTACCGCTGATGCTGCCGTTCGGGGGCGAACGTG
GTGACTTCAACATTCCCGCCAACTCGGTGATCAAGGATATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGTGTGCCCCTGGGCAAGGGCCTGATCTGGCGGTTGATCGCCCACCTGTCGCTGAACCATATGTCGCTG
GTCAGCCAGGGCCGCGAAGTGCTGCTGGAGCTGTTGTCGCTGTACAACTACCGCAATGTTTCCGCCATTC
GCAAACAGATCAACGGCATCAAGGCGATCAGCAGCGAGCCGGTGGTCGCACGCATCGGCCACCCGCGGCC
GAACTTCGTACGTGGCGTCGGCATCACGCTGACCCTGGATGAAAGCCAGTTCATCGGCAGTGGCGTGTAC
CTGTTCGGCATGGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGCTTCACCCAACTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTCCAATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTG
A
 Primer design