SecReT6
Protein ID: 431802756
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14110
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3100044..3101114 [+]
Producthypothetical protein
NoteTssG
UniProt IDL0FLU6
KEGG IDppuh:B479_14110
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.10E-104, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|431802756|ref|YP_007229659.1| hypothetical protein B479_14110 [Pseudomonas putida HB3267]
MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSD
LHFEREGKVSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQQLKFEQQPTALRRELFSYFAGLLSQKPRNALNLERM
LGFYFSLPIKVRQFAGRWLHLQPEQCTQLGRRNAQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQP
GTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIP
YDGVAL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3100044-3101114 Pseudomonas putida HB3267, complete genome
ATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTGATCGATCAGGCCCGAGCCGAGCCGCACCGATTCG
AATTCTTTCAATTGGTGCGCCTGCTCCGCCTGCACTACAGCCGTACCGGGCGCATGGACCTGGCAACCCG
GCCGCACGAAGACCCGCTGCGTTTTCGTACCCAGCTTTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGAC
CTGCACTTCGAGCGCGAAGGCAAGGTGTCGCCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCA
TGGGCCTGGTCGGGCCGTCGGGCGTACTGCCGCGCCCGTATACCGAGCTGCTGCTGGAGCGCCACGTGCA
GTATCGCGACGATGCCGCCCACGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGCTGTTCTACGAG
GCCTGGCAGAAGTACAAATTTCATATCGAGCACGAGCGCAATGGCACTTCGGGCTTCGATGGCTACCTGC
TCAACCTGGTCGGCCTCGGCCCGCGCGCGCAGCAACTCAAGTTCGAGCAGCAACCAACCGCGCTGCGCCG
CGAGCTGTTCAGCTACTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAACGCGTTGAACCTCGAACGCATG
CTCGGCTTCTATTTCTCGCTGCCGATCAAGGTCCGCCAGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCG
AACAATGCACCCAGCTTGGCCGCCGCAATGCCCAGCTCGGCCACAGCGCCGTAGCCGGCAACCGGGTCTG
GGACTACCAGTCGTGCATCCGCATCGAGCTGGGGCCGCTGAGCCTGGCCGATTACCAGCGCTTCCAGCCG
GGCACCGCGTGCTACCGCAAGCTGGTCGAGCTGGTGCGCTTCTATATAGGCGCCGAACTGGATTTCGAAA
TTGCCCCGCGCCTCAAGCGCGAGGCGGTGCCACGCGCCCAGCTGGGCCGCAGTGGCAATGTCGCCCTGGG
CTGGCTGGGCTGGCTCAAACGCCCTGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTCTTCCACATTCCT
TACGATGGGGTCGCCTTGTGA
 Primer design