SecReT6
Protein ID: 431802757
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14115
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3101111..3103708 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDL0FKA3
KEGG IDppuh:B479_14115
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.50E-44, Aligned region: 34..46
AAA_2 [PF07724], Evalue: 5.50E-44, Aligned region: 225..245
AAA_2 [PF07724], Evalue: 5.50E-44, Aligned region: 596..763
AAA_2 [PF07724], Evalue: 5.50E-44, Aligned region: 817..837
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 61..79
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 225..338
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 602..720
AAA_5 [PF07728], Evalue: 3.00E-14, Aligned region: 225..247
AAA_5 [PF07728], Evalue: 3.00E-14, Aligned region: 601..722
ClpB_D2-small [PF10431], Evalue: 5.70E-14, Aligned region: 772..843
AAA_22 [PF13401], Evalue: 3.00E-10, Aligned region: 224..308
AAA_22 [PF13401], Evalue: 3.00E-10, Aligned region: 342..445
AAA_22 [PF13401], Evalue: 3.00E-10, Aligned region: 599..638
AAA_16 [PF13191], Evalue: 1.90E-08, Aligned region: 31..154
AAA_16 [PF13191], Evalue: 1.90E-08, Aligned region: 202..248
AAA_16 [PF13191], Evalue: 1.90E-08, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.90E-08, Aligned region: 462..520
AAA_16 [PF13191], Evalue: 1.90E-08, Aligned region: 596..642
AAA_16 [PF13191], Evalue: 1.90E-08, Aligned region: 666..690
AAA_16 [PF13191], Evalue: 1.90E-08, Aligned region: 788..803
Clp_N [PF02861], Evalue: 5.70E-08, Aligned region: 21..73
Clp_N [PF02861], Evalue: 5.70E-08, Aligned region: 103..124
Sigma54_activat [PF00158], Evalue: 5.90E-07, Aligned region: 221..258
Sigma54_activat [PF00158], Evalue: 5.90E-07, Aligned region: 601..727
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 278..379
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 600..642
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 667..695
AAA_19 [PF13245], Evalue: 4.70E-06, Aligned region: 225..246
AAA_19 [PF13245], Evalue: 4.70E-06, Aligned region: 599..623
AAA_17 [PF13207], Evalue: 9.90E-06, Aligned region: 225..319
AAA_17 [PF13207], Evalue: 9.90E-06, Aligned region: 602..639
NACHT [PF05729], Evalue: 1.00E-05, Aligned region: 225..254
NACHT [PF05729], Evalue: 1.00E-05, Aligned region: 601..626
NACHT [PF05729], Evalue: 1.00E-05, Aligned region: 709..749
AAA_14 [PF13173], Evalue: 4.40E-05, Aligned region: 225..358
AAA_14 [PF13173], Evalue: 4.40E-05, Aligned region: 600..682
IstB_IS21 [PF01695], Evalue: 6.30E-05, Aligned region: 219..247
IstB_IS21 [PF01695], Evalue: 6.30E-05, Aligned region: 601..620
Zeta_toxin [PF06414], Evalue: 0.00049, Aligned region: 137..168
Zeta_toxin [PF06414], Evalue: 0.00049, Aligned region: 220..249
Zeta_toxin [PF06414], Evalue: 0.00049, Aligned region: 595..641
AAA_18 [PF13238], Evalue: 0.00054, Aligned region: 225..267
AAA_18 [PF13238], Evalue: 0.00054, Aligned region: 603..626
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 225..249
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 282..320
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 350..381
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 478..497
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 599..625
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 218..241
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 599..626
AAA_23 [PF13476], Evalue: 0.0032, Aligned region: 225..241
AAA_23 [PF13476], Evalue: 0.0032, Aligned region: 464..504
AAA_23 [PF13476], Evalue: 0.0032, Aligned region: 599..697
RNA_helicase [PF00910], Evalue: 0.0087, Aligned region: 226..246
RNA_helicase [PF00910], Evalue: 0.0087, Aligned region: 602..623
RNA_helicase [PF00910], Evalue: 0.0087, Aligned region: 702..720
Protein Sequence: 865 a.a.     [Download]
>gi|431802757|ref|YP_007229660.1| type VI secretion ATPase [Pseudomonas putida HB3267]
MNLKSLFAKLNETSRTATESAAALCLSEHHYDVEVEHLLLQLLDNSDSDLAPILRHYEVVAERLQAQLVT
ALGTFKKGNTRTPALSPHITRMIEQAWLLASIEYGVGQVRSAHLLQALLDDAELRRVVIASAPELEKINA
DDLRLNLAALVEGSAESRQASPLASPAAPVNSASKAGGKTPALDQYTVNLTQSAREGRIDPVLGREFEVR
QMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIAQGDVPAVLKDVALHTLDLGLLQAGAGVKGEFENR
LKAVIEEVKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQVVKVEEPDEDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTAC
ARIALAQSSQPGALEDCRRQIDNLQAEIAVLGHEAGKGHDHTRRLGELQAALQAEQQREQQLNTQWQQEL
ELVEQLKALDAASEADAKQLNALRAELARVQGDQPLVHALVDSGAIAQVISGWTGIPLGKMLRDEIDTVQ
RLPALLGERVLGQDHALHEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERNLI
TINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLD
DGEGREINFRNTVIILTSNTGTERIMQTCLNATELPTPAAIVEDLRDQLNHVFKPAFLGRLSIVPFYPVQ
DQILERIVALKLERIAKRFARNHQAELSYDQALVKAIAARCTEVDSGARNIDNILSQTLMPELAQRVLER
MAQDTPIQRLAIELGSDGDFAYRVA
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3101111-3103708 Pseudomonas putida HB3267, complete genome
GTGAACCTGAAGTCTCTGTTCGCCAAGCTCAACGAAACCAGCCGCACGGCCACGGAAAGCGCGGCGGCCC
TGTGCCTGTCGGAGCACCATTACGACGTGGAGGTGGAGCATCTGCTGCTGCAGTTGCTCGATAACAGCGA
CAGCGACCTGGCGCCGATCCTGCGCCACTACGAAGTAGTCGCCGAGCGCTTGCAGGCGCAGCTGGTCACG
GCCCTGGGCACCTTCAAGAAAGGTAATACCCGCACCCCGGCGCTGTCGCCGCACATCACCCGCATGATCG
AACAGGCCTGGTTGCTGGCGTCGATCGAATACGGCGTCGGCCAGGTGCGCAGCGCTCACCTGCTGCAGGC
CCTGCTCGACGATGCCGAACTGCGTCGCGTGGTGATCGCCTCGGCGCCGGAGCTGGAGAAAATCAACGCC
GATGACCTGCGCCTGAACCTTGCCGCGCTGGTGGAAGGCAGCGCCGAGTCCCGGCAGGCCAGCCCGCTGG
CCAGCCCGGCAGCGCCAGTGAACAGTGCGAGCAAGGCCGGCGGCAAGACCCCGGCGCTGGACCAGTACAC
GGTCAACCTCACCCAGAGCGCCCGCGAAGGCCGCATCGACCCGGTGCTGGGCCGCGAGTTCGAAGTAAGG
CAGATGGTCGATATCCTTACCCGTCGCCGCCAGAACAACCCGATCCTCACGGGCGAGGCCGGGGTCGGCA
AAACCGCCGTGGTCGAAGGCCTGGCCCTGCGCATCGCCCAAGGTGACGTGCCGGCGGTGCTCAAGGATGT
GGCCCTGCACACCCTCGACCTGGGCCTGCTGCAGGCCGGCGCCGGGGTCAAGGGCGAGTTCGAGAACCGC
CTCAAGGCAGTGATCGAAGAGGTCAAACGCAGCCTGCACCCGATCATCCTGTTCATCGACGAAGCCCACA
CTTTGATCGGTTCCGGTGGCCAGGCCGGGCAGAACGATGCCGCCAACCTGCTCAAGCCGGCCCTTGCCCG
TGGCGAGCTGCGCACCATCGCCGCCACTACCTGGGCCGAATACAAGAAGTACTTCGAGAAGGACGCCGCC
CTCGCCCGCCGCTTCCAGGTGGTCAAGGTGGAAGAACCCGACGAAGACAAAGCCATCCACATGCTGCGCG
GCCTGCTCGGCAAGATGCGCGAACACCACAAGGTAGCGGTGATGGACGAAGCGCTGGTGCAGGCCGTGCG
CCTGTCCAACCGCTACATCACCGGCCGCCAGCTGCCCGACAAGGCGGTCAGCGTGCTCGACACCGCCTGC
GCGCGCATTGCCCTGGCGCAATCGTCGCAACCTGGCGCCCTGGAAGACTGCCGCCGCCAGATCGACAACC
TGCAGGCCGAAATCGCCGTGCTCGGCCACGAAGCCGGCAAAGGCCACGACCACACTCGCCGCCTGGGCGA
GCTGCAGGCTGCCCTGCAGGCCGAGCAGCAGCGGGAGCAGCAGTTGAACACGCAGTGGCAACAGGAGCTG
GAACTGGTCGAACAGCTCAAGGCGCTGGACGCCGCCAGCGAGGCCGATGCCAAGCAGCTCAACGCCCTGC
GTGCCGAACTGGCCCGCGTGCAAGGCGACCAGCCTCTGGTCCATGCCCTGGTCGACAGCGGCGCCATCGC
CCAGGTCATCAGCGGCTGGACCGGTATCCCGCTGGGCAAGATGCTGCGTGACGAGATCGACACCGTGCAG
CGCCTGCCGGCCCTGCTTGGTGAGCGCGTGCTGGGCCAGGACCACGCCCTGCACGAAATCGGCAAGCGCA
TCAAGATTTCCCGCGCACGCATGGAAGACCCGAACAAACCGATCGGTGTGTTCCTGCTGCTCGGCCCCAG
CGGCGTCGGCAAGACCGAAACCGCCCTGGCCCTGGCCGATACCCTGTACGGCGGTGAACGCAACCTCATC
ACCATCAACATGTCCGAGTACCAGGAAGCCCACACCGTTTCGAGCCTCAAGGGCTCGCCTCCGGGCTATG
TCGGCTACGGCGAAGGCGGCGTGCTGACCGAGGCGGTGCGTCGCAAGCCGTACAGCGTGGTGTTGCTCGA
CGAGGTGGAAAAAGCCCACCCCGACGTGCTCGAACTGTTCTTCCAGGTGTTCGACAAGGGCGTGCTGGAC
GATGGCGAAGGCCGCGAGATCAATTTCCGCAACACGGTGATCATCCTCACTTCCAATACCGGTACCGAGC
GCATCATGCAGACCTGCCTGAACGCCACCGAGCTGCCGACGCCCGCAGCGATCGTCGAAGACCTGCGTGA
CCAGCTCAACCATGTGTTCAAGCCGGCCTTCCTCGGCCGCCTGAGCATCGTGCCGTTCTACCCGGTGCAG
GACCAGATCCTCGAGCGCATCGTCGCCCTCAAGCTCGAACGCATCGCCAAGCGCTTCGCCCGCAACCACC
AGGCCGAGCTCAGCTACGACCAGGCGTTGGTCAAGGCCATCGCCGCGCGCTGCACCGAGGTCGACAGCGG
TGCCCGCAACATCGACAACATCCTGTCCCAGACCCTGATGCCCGAGCTCGCCCAGCGCGTGCTCGAGCGC
ATGGCCCAGGACACGCCGATCCAGCGTCTTGCGATCGAGCTGGGCAGCGATGGCGATTTCGCCTATCGCG
TGGCCTGA
 Primer design