SecReT6
Protein ID: 431802758
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14120
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3103733..3104455 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDL0FL30
KEGG IDppuh:B479_14120
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-34, Aligned region: 18..172
Protein Sequence: 240 a.a.     [Download]
>gi|431802758|ref|YP_007229661.1| putative lipoprotein [Pseudomonas putida HB3267]
MQHKHTALKRLTTAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDTPEKALGNTLVEAREITLLPGIGQIDQWPLAKSARYVGVAAFFRNEQD
ARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKARDNAPTLTDKVQD
AVLDKASDAASKSAQNTMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3103733-3104455 Pseudomonas putida HB3267, complete genome
ATGCAACACAAGCACACCGCCCTCAAACGCCTGACCACAGCTGCCTTGCTGGTGGCGCTGGCCGGCTGCG
GGGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAA
GGTCATCCTGACCTCCGACGGCGGCAACCAGCTCAACCCCGATGCCGAGGGCAAGCCGCTGTCGGTGGTG
ATGCGCGTGTACCAGCTGACCGACCTCGAACGCTTCGCCGCGACCGATGCCGAGACCCTGTGGGACACCC
CGGAAAAGGCCTTGGGCAACACCCTGGTGGAAGCCCGCGAAATCACCCTGCTGCCGGGCATCGGCCAGAT
CGACCAATGGCCACTGGCCAAAAGCGCTCGCTACGTCGGCGTGGCAGCTTTCTTCCGCAACGAACAGGAC
GCGCGCTGGAAGGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCTTCCGACGGCC
TGCGGGTGCTGGTGGACAACACCGAAATCAGCGCCATGCGTGGCGTCGACGTACTGAACAAACCGCCGAC
TGCCGACCAGCTGGCAGCCGCGCAGAAGGCCCGGGACAACGCACCGACGCTCACCGACAAGGTGCAGGAC
GCCGTGCTCGACAAGGCCAGCGATGCCGCCAGCAAATCGGCACAGAACACCATGGATTCAACCTTCAACT
CTTTAGTGGATAGCGTCAAATGA
 Primer design