SecReT6
Protein ID: 431802759
SecReT6 ID715
T6SS typei4b
Gene symbol-
Locus tagB479_14125
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3104452..3105795 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDL0FID3
KEGG IDppuh:B479_14125
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-137, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|431802759|ref|YP_007229662.1| type VI secretion protein [Pseudomonas putida HB3267]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRTTPFHWGVQVLQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVHAALKLPEPFGLNYVEDGQEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLARLTRNSMGGFNLDPHFVHPTLHLGSHETLAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLNQTKPSYWQGQLHDPRLTEADFYI
SVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGHVYER
MMNAQTICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3104452-3105795 Pseudomonas putida HB3267, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTACCAGG
ATGAGTTCCACCAGCACCAGCTGGCCGAGGCGACCCTGCGCACCACCCCATTCCATTGGGGTGTGCAGGT
ACTGCAGGTGGATGAGGACGCCCTGGCCAACGGTTCGCTGCAGCTCAAGCGCCTCAAGCTGGTGTTCCCC
GATGGCAGCCTGTACGACGCGCCGCAGCATGACCCGCTGCCGGCTGCCCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTCAAGGTCCATGCTGCCTTGAAACTGCCCGAGCCATTCGGCCTGAACTATGTCGAGGA
CGGCCAGGAACACAAGGCCGCGCGGCGTTTCCGCAAGCAGTTCGATACCCTGCCCGACCTCAATGAAGGC
GAGCTGGAAAACGAAATCACCAGCCTGCGCCTGAACGTGGTGCTGCTGGTGGACGGTGACAGCCTGGACG
GCTACAGCCACTGCCCGCTGGCCAGGCTGACCCGCAACAGCATGGGCGGTTTCAATCTCGACCCGCATTT
CGTCCACCCCACTCTGCATCTGGGCAGCCACGAGACCCTGGCCGGCATCGGCAAGCGCCTGCTCGGCGCC
CTGCAGGCCAAGAGCAAGGCCCTGTCCGGCCGACGCCGCGAACGCGCCGACCAGATCGCCGAGTTCGGCT
CCAGCGACGTAACCCTGTTCTGGCTGCTGAACACCGTCAACCGCGCCCACCCGCAGCTGGCCCATCTGCT
GGCGCACCCGCGCCTGCACCCCGAGCGCCTGTACCTGTTCCTCGCCGACCTGGCGGGTGGCCTGCTGACG
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAATACGACCATCACGACCCGGCCGCGTCGCTGGTCA
AGCTCGACGAGATGATCCGGGTGATGCTCGACAACGTGGTGCCCAACCAGTGCATCGTCATCAACCTCAA
CCAGACCAAGCCGTCGTACTGGCAGGGCCAGTTGCACGATCCACGCCTGACCGAGGCCGACTTCTATATC
TCGGTCCATGCCGACATGCCTGGTGCCAGCCTGCTGGAGCTGGTACCGCGGGCATTCAAGGTCGGCTCGC
CGGAAGACATCGAGGTGGTGGTCAACAGCGCGATGCCCGGCGTCACGCTCAACCATGCCGCACGGCTGCC
CAACGCAATTCCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAGCCGCATGGCCATGTCTACGAGCGA
ATGATGAATGCCCAGACCATCTGCTTCTACGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA
 Primer design